DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14331 and PSR

Sequence 1:NP_001097824.1 Gene:CG14331 FlyBaseID:FBgn0038510 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001262832.1 Gene:PSR FlyBaseID:FBgn0038948 Length:441 Species:Drosophila melanogaster

Alignment Length:301 Identity:56/302 (19%)
Similarity:99/302 (33%) Gaps:98/302 (32%)


  Fly    69 EMQGKNCALYLPRNLRYAFRPPENCNFCANIKNVPRLKNISPQEFEKKFAYSAAPVIISDATKNW 133
            |:.|:|..    ..:||..:.....:|..|::.:.. ..:...||.::|.....||:|...|..|
  Fly    25 ELDGENAW----SAMRYCEKFEPFWDFTDNLERIEE-SQVPESEFIERFERPYKPVVIRGCTDGW 84

  Fly   134 TAVSLFNYWYFRDVYTKAKQKQHIRECQFLPYKTGFLDIYDALDMPEDR----VELKPGEQPWYF 194
            .|:         :.:|.|:..:..|..:|   |.|           ||.    |::|   ..:|.
  Fly    85 LAL---------EKWTLARLAKKYRNQKF---KCG-----------EDNEGYSVKMK---MKYYV 123

  Fly   195 GWSNCHAETA------EEFRRHYGR-----PYFLPEGSENNAVD-----------WFFIGLSGLG 237
            .:.....:.:      ..|..|:.|     .|.:|:...::...           ||.:|.:..|
  Fly   124 EYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWFVMGPARSG 188

  Fly   238 AQMHIDNVRLPSWQAQLAGSKRWLLVPP------------------------------------- 265
            ..:|||.:...:|...:.|.|||.|.|.                                     
  Fly   189 TGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELLKVTSAMGGKQRDEAITWFSTIYPRTQLPSW 253

  Fly   266 PECYLQCRRFDVVVQQGDIIVLDTNKWYHQTFVQPGAISLT 306
            ||.|   |..:|:...|:.:.: ...|:|........|::|
  Fly   254 PEQY---RPIEVLQGAGETVFV-PGGWWHVVLNMDDTIAIT 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14331NP_001097824.1 cupin_like 110..>265 CDD:304367 39/181 (22%)
PSRNP_001262832.1 JmjC 179..293 CDD:202224 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111015118
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12480
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.