DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14331 and Jmjd8

DIOPT Version :9

Sequence 1:NP_001097824.1 Gene:CG14331 / 42099 FlyBaseID:FBgn0038510 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_006246060.1 Gene:Jmjd8 / 360498 RGDID:1307381 Length:317 Species:Rattus norvegicus


Alignment Length:260 Identity:55/260 - (21%)
Similarity:85/260 - (32%) Gaps:78/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ENCNFCANIKNVPRLKNISPQEFEKKFAYSAAPVIISDATKNWTAVSLFNYWYFRDVYTKAKQKQ 155
            |.|       .|.|..:::..||.:.:|: ..|||:...|.|    |.|.....|:....:....
  Rat    68 ERC-------TVERRAHLTYSEFMQHYAF-LKPVILQGLTDN----SKFRALCSRENLLASFGDN 120

  Fly   156 HIRECQFLPYKTGFLDIYDALDMP-EDRVE--LKP------GEQPWYFGWSNCHAETAEEFRRHY 211
            .:|......|.      |..:|:| ::.||  |.|      |....||...|...|.|..| :||
  Rat   121 VVRLSTANTYS------YQKVDLPFQEYVEQLLHPQDPESLGNDTLYFFGDNNFTEWAPLF-QHY 178

  Fly   212 GRPYFLPEGSENNAVDWFFIGLSG-LGAQMHIDNVRL------------------------PSWQ 251
            ..|.|...|:    ...:..|::| ...|..:...|:                        |.:.
  Rat   179 RPPPFRLLGT----TPAYSFGIAGRCSFQTDLGEARIYFVHQLFTTDPTGAGSGVPFHWHGPGFS 239

  Fly   252 AQLAGSKRWLLVPP--------------------PECYLQCRRFDVVVQQGDIIVLDTNKWYHQT 296
            ..:.|.|||.|.||                    |......|..:..:|.|:.:.. .::|:|.|
  Rat   240 EVIYGRKRWFLYPPEKTPEFHPNKTTLAWLLEIYPSLAPSARPLECTIQAGEALYF-PDRWWHAT 303

  Fly   297  296
              Rat   304  303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14331NP_001097824.1 cupin_like 110..>265 CDD:304367 42/188 (22%)
Jmjd8XP_006246060.1 cupin_like <241..301 CDD:304367 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.