DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14331 and JMJD4

DIOPT Version :9

Sequence 1:NP_001097824.1 Gene:CG14331 / 42099 FlyBaseID:FBgn0038510 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001286031.1 Gene:JMJD4 / 35089 FlyBaseID:FBgn0032671 Length:425 Species:Drosophila melanogaster


Alignment Length:286 Identity:53/286 - (18%)
Similarity:94/286 - (32%) Gaps:98/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KNVPRLKNISPQEFEKKFAYSAAPVIISDAT-----KNWT---------------AVSLFNYWYF 144
            :.:.|...:...:|..::.:...||||::.:     :|||               :.|..|:.|.
  Fly    28 EEIERCSGLDYNDFFWRYMHKNIPVIIANVSNDWECQNWTVGQSSPESRDLNSNPSASSINFDYL 92

  Fly   145 R------------------DVYTK---------AKQKQHIRECQFLPYKTGFLDIYDALDMPEDR 182
            :                  :.:||         ||.:..|.......:.:..:: .:......|.
  Fly    93 KTKISDGPVPVANCNSSYFNSHTKLELNFHDYLAKWRSSIESQSSAAWTSAEVN-SNVAPASGDN 156

  Fly   183 VELK--------PG----EQPWYFG--WSNCHAETAEEFRRHYGRPYFLPEGSENNAVDWFFIGL 233
            :.||        ||    :.|.||.  |.|  .:..::.:..|...|..|:.|      |     
  Fly   157 LYLKDWHLAAQMPGYNFYKVPKYFASDWLN--EQLIQQGKDDYRFVYMGPKNS------W----- 208

  Fly   234 SGLGAQMHIDNVRLPSWQAQLAGSKRWLLVPP-PECYLQCR------------------RFDVVV 279
                ...|.|.....||...:.|.|:||::|| .|..|..|                  |:..:.
  Fly   209 ----TSYHADVFGSFSWSTNIVGLKKWLIMPPGEELKLNDRLGNLPFSIDEKMLDEHNVRYYTIN 269

  Fly   280 QQGDIIVLDTNKWYHQTFVQPGAISL 305
            |:.:..|...:.|:||.:.....||:
  Fly   270 QRANEAVFVPSGWFHQVWNLTDTISV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14331NP_001097824.1 cupin_like 110..>265 CDD:304367 39/215 (18%)
JMJD4NP_001286031.1 JmjC 172..221 CDD:214721 12/65 (18%)
JmjC 199..299 CDD:202224 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12480
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.