DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mur89F and CG17145

Sequence 1:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster

Alignment Length:335 Identity:69/336 (21%)
Similarity:100/336 (30%) Gaps:120/336 (36%)


  Fly     7 PFSQLD--KMATRTSTSTSSWLCRLLLFGFCIGAAAARDIRSPMDQTDVAFYCPGEGLFADDYDC 69
            ||...|  |.....||||||          |..:.|.|                .:...||...|
  Fly    66 PFFDKDTGKCVKSLSTSTSS----------CSISCADR----------------AKQFVADPKSC 104

  Fly    70 RIYYRC-ERRSGQYIQPYLLACPEDAVFSRTLRMCLPPAMSGRDECVDQV--------NEVDGDS 125
            ..||.| :..:..|     ..||::..|:.|.:||   :.....:|....        |.|:.|:
  Fly   105 YGYYYCADEETALY-----GTCPQETHFNATTQMC---SRQHESDCTTSTFEYCSIVKNGVNFDN 161

  Fly   126 M---------EKWEQDD------YGQDDHNAMLNLAVTPAANELRTYASTHRLPTNYGLAGLNGV 175
            :         ||....|      |.|......::.|:..        ...|.|||:         
  Fly   162 LQGCNMYHVCEKGVLKDKTCSKTYYQASTGECVSKALVD--------CDAHPLPTD--------- 209

  Fly   176 SVISFSSSSSLRAVGSAEEDGIICRDDGFMTDPSDCTVFYRCISNGRGY---NKIGFRCSDGTAW 237
                        ..|.|.:.    .::.|:.|.:.|..::.|.....|.   |.:..:|.....:
  Fly   210 ------------VCGKASKP----YENKFVADEATCRGYFYCAKQKDGTPDPNPVWNQCPQDRFF 258

  Fly   238 DESLQS--------CNH--------MFDVRANGGCRNQAVPQNDGYYAGQTSTQSSQTSYQNSTT 286
            |.|.|.        |:|        .|.|.|..||||        |.:.......|:.|..|...
  Fly   259 DASSQMCITPSSVYCSHDRCDGRTASFVVSATKGCRN--------YLSCSDGVTVSERSCGNYFF 315

  Fly   287 SSQQSSSTSS 296
            ..||.:.|.|
  Fly   316 DDQQGACTPS 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884 13/50 (26%)
CBM_14 200..250 CDD:279884 13/69 (19%)
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 15/75 (20%)
CBM_14 278..327 CDD:279884 15/57 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.