DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mur89F and obst-F

Sequence 1:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster

Alignment Length:319 Identity:73/320 (23%)
Similarity:103/320 (32%) Gaps:94/320 (29%)


  Fly  1749 TTGEPITTTTLPSTT--TDAIQEPTTSKKPEPTTTTESPESSTPEGSVTTLQPEPQPNYNCSSEG 1811
            |...|:.|.|:.|..  .|..:......||:|........|..|...:....||   :..|...|
  Fly    92 TNCRPVATGTVESANGLADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDPE---HIECRHYG 153

  Fly  1812 --FFPDPEDCSRYYRCVDAAKNGKYQVYAFKCGKGTVWDTSTETCNYADQVSGNC-SSGQTTTPG 1873
              |.|.|.:|..|:.|...      .::..:||:||.|:.....|..:||..  | ...|.:.|.
  Fly   154 AYFLPHPRNCGLYFICAYG------HLHRHQCGRGTAWNFEKSECQLSDQAI--CYGESQISEPH 210

  Fly  1874 TTTEPGTTESTTSSGKPETTSKAPENTTTWAPETTTTSSPETTTTV-----ASETTTTTSGTTTT 1933
            |..              |||.|.|            |::.|...||     :||.||.....|  
  Fly   211 TDV--------------ETTMKVP------------TANSEGAVTVCYIVGSSEYTTLQQFLT-- 247

  Fly  1934 ATPETTTKPPKPETTTIAGEETSTSKSPTTTESPAPSTNTSAPCPETGPGQNVYVCPTGFRRHPE 1998
             :||.|..|                  |.|..||..:...:..||.|         ...:..|||
  Fly   248 -SPEITELP------------------PVTPPSPPRAEANALTCPST---------KQSYMSHPE 284

  Fly  1999 KCGMFYQCSESADNNDLNIVVFQCPNGTVYQDKSCSCGKPPAGDKCSKDMKRTTNAFEE 2057
            .|..:|.|.....      |:..||.|..:..||..|           :|::....|::
  Fly   285 DCSKYYICIGGMP------VLTSCPKGLFWDQKSGFC-----------EMEKNVKCFQK 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884 15/54 (28%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 1/2 (50%)
CBM_14 156..198 CDD:279884 14/48 (29%)
CBM_14 272..321 CDD:279884 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.