DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mur89F and CG10140

Sequence 1:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster

Alignment Length:301 Identity:60/302 (20%)
Similarity:96/302 (32%) Gaps:70/302 (23%)


  Fly  1771 TTSKKPEPTTTTESPESSTPEGSVTTLQPEPQPNYNCSSEGFFPDPEDCSRYYRCVDAAKNGKYQ 1835
            ||....|..:||...|.....|:::...       |.:...|.|...||:|||.|    ::|  |
  Fly    29 TTDSTLETDSTTSGLEYGLITGNLSICG-------NVADNVFLPFVGDCNRYYLC----RSG--Q 80

  Fly  1836 VYAFKCGKGTVWDTSTETCNYADQVSGNCSSGQTTTPGTTTEPGTTESTTSS------------- 1887
            ....:|.....::.:|::|.:               ||......|.|:...|             
  Fly    81 AIELQCEWPYEFNANTQSCVH---------------PGDADCLPTCEAFNFSTFSYQRTCTRYVL 130

  Fly  1888 ---GKPETTSKAPENTTTWAPETTTTSSPETTTTVASETTTTTSGTTTTATPETTTKP------- 1942
               |||  ..:..::...:...|.....|:....|.||.:..::.......|...:..       
  Fly   131 CYYGKP--VLRQCQDGLQYNSATDRCDFPQNVDCVESECSIYSNAYHLRYVPSKVSCQKYFICGN 193

  Fly  1943 --PKPETTTIAGEETSTS----KSPTTTESPAPSTNTSA-PCPETGPGQNVYVCPTG---FRRHP 1997
              |:.:|.| ||...||.    ..|:.::...|:..... ......|...|.:||..   |..|.
  Fly   194 GIPREQTCT-AGLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHE 257

  Fly  1998 EKCGMFYQCSESADNNDLNIVVFQCPNGTVYQDKSCSCGKP 2038
            .:...:|.|   .|.:.|   |..|..|..|......|.:|
  Fly   258 SRRDAYYYC---VDGHGL---VLDCSAGLWYDPTVQECREP 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884 13/52 (25%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 15/64 (23%)
CBM_14 111..161 CDD:279884 7/52 (13%)
CBM_14 178..222 CDD:279884 9/45 (20%)
CBM_14 246..295 CDD:279884 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.