DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mur89F and CG7248

Sequence 1:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster

Alignment Length:1034 Identity:209/1035 (20%)
Similarity:320/1035 (31%) Gaps:359/1035 (35%)


  Fly  1173 SSSSSNNNNQG---SSSSSSSSSSSTSSKPNPSETCKVNGQFIGDRSDCAKFYRCVDNDRGGFNM 1234
            ||...||.||.   |.|..:|.....||:.|.:....::..|.....:|:.:..|.|        
  Fly    28 SSVGWNNVNQNVILSFSKRNSHECVVSSQQNSTYCESLSNGFYEYPYNCSAYITCYD-------- 84

  Fly  1235 VPFSCG------PGTVWDAQMQACNHAWAVKECGGIAPPTTSTPTTSRPTTASTSRPSDQTSTSR 1293
               ||.      .|.::::.:|.|:...|| :|..:..||.| ||.|.|                
  Fly    85 ---SCADLEYCPDGKLFNSPLQICDTPGAV-DCEPLPYPTPS-PTESPP---------------- 128

  Fly  1294 PTGPPTTARPVTARPTTSSPTTASSSQTTSPVTQAPNTDGKCRSEGFMADPNNCSKFYRCVRNNK 1358
                             .:|...:.:.|..|..:                  ||::||.||.:. 
  Fly   129 -----------------ENPCLGTRNNTLLPSAE------------------NCNEFYLCVNDQ- 157

  Fly  1359 GGFTSIPFQCGAGTVWDQDLQTCNHNFNNCSTGTESTTPKP------------PCEPATNGTTAT 1411
                |..::|....:::.||..|:...|....| :.|||.|            .||....||...
  Fly   158 ----SKVYRCPGEMLFNPDLNICDDKDNVWCYG-DRTTPDPLDTTTPAEESFTKCEDQEKGTFFP 217

  Fly  1412 -------------STSSTTTPPPTTTDLPPTSTTGLPPTTTTELPPTTTTDLPPTTTTRLPPTTT 1463
                         :.|.|..|.|......|.|....|             |:.|.......||:|
  Fly   218 DPENCQQYYYCWGNKSYTILPCPVDNWFNPISGNCGP-------------DIAPDACRETTPTST 269

  Fly  1464 TSLPPTTTTGLPPTTTTGAQPTTTTLSSETETSTVTTSPESTTQPPSTTTMKPLPAGTECTGEGY 1528
            .::..:::|.:.||:|..:                                    .|..|     
  Fly   270 PTIDTSSSTTVAPTSTEDS------------------------------------VGNPC----- 293

  Fly  1529 MADPE---------DCRKYYRCINAGASYRKYNFTCPKGTGWNEEVQTCDYVENIPRCSKLPAEP 1584
             ||.|         ||:.|..|:|.|.|   ....||....::.:...|.     |..|      
  Fly   294 -ADQELGASFPIKSDCQSYLLCLNNGES---TTAKCPSNAWFDPKTGDCG-----PNVS------ 343

  Fly  1585 ITTTPSEESKDPGSTTPQSTDEPTTVTKPITKPTEEPSTEKPQKPTTQYPEKPTTTEEPEKPQKP 1649
                                                        ||.......|||         
  Fly   344 --------------------------------------------PTACLESFETTT--------- 355

  Fly  1650 TTTEYPQKPTTTEEPTPEKPQKPTTTEYPQKPTTTEEPTPEKPQKPTTTEYPQKPTTEEPTTTSI 1714
                                 ...||:.|:.|...:|         ..|.||.....::..... 
  Fly   356 ---------------------TAVTTQAPKDPCADQE---------LGTSYPLVTNCQQYILCM- 389

  Fly  1715 PGYNPTTTSVPGYNPTTTPIPVETTTSTPGYKPTTTGEPITTTTLPSTTTDAIQEPTTSKKPEPT 1779
             |...:|.:...||....|   :|....|...||...|...||..|:||:.|....||   |.||
  Fly   390 -GNGESTVANCIYNSWFDP---QTGNCGPDVSPTACKESGVTTASPTTTSQATSPLTT---PSPT 447

  Fly  1780 TTTESPESSTPEGSVTTLQPEPQPNYNCS--SEGFFPD-PEDCSRYYRCVDAAKNGKYQVYAFKC 1841
            .:| .|.::|.|   ||..| |.....||  |:|::.. ||.|::|..|.....      .||.|
  Fly   448 WST-LPTANTEE---TTTNP-PDIVGICSGESDGYYATYPEVCNKYILCASPVP------IAFYC 501

  Fly  1842 GKGTVWDTSTETCNYADQVSGNCSSGQTTT--PG-TTTEPGTTESTTSSGKPETTSKAPENTTTW 1903
            .:...::.:.:.|  .:..|.:||:|:|||  || ||..|.|...:.|:|    .:...:....|
  Fly   502 PESLFFNEALQRC--VEWESSDCSNGETTTSSPGFTTPSPDTQICSNSTG----LNLPYQENCQW 560

  Fly  1904 APETTTTSSPETTTTVASE-----TTTTTSGTTTTATPETTTKPPKPETTTIAGEETSTSKSPTT 1963
            ....|..:|.......:.|     |.....|.:..|..|..|..|     |:    |.:::.|||
  Fly   561 YIYCTDENSYMMGICGSEEYFDPWTGKCGFGVSPEACREIQTTSP-----TV----TDSTEGPTT 616

  Fly  1964 TESPAPSTNTSAPCPETGPGQNVYVCPTGFRRHPEKCGMFYQCSESADNNDLNIVVFQCPNGTVY 2028
            ..:|:...:...||.....|:.|        .:|:.|..|.||.:.      :.:|:.|..|..:
  Fly   617 VITPSTPGSEPDPCDGAPEGKLV--------PYPDDCSKFIQCIQP------DPIVYDCREGQEF 667

  Fly  2029 QDKSCSCGKP-------PAGDKCSKDMKRTTNAFEEETKLQNVVQISTTDPLCPD--EGHFALNN 2084
            ......|..|       ||.......:..||...|:          .:.:.:|.|  ||......
  Fly   668 SAALERCMAPWFANCSIPATTIPPVTIPTTTTTTEK----------PSPNGICADKAEGSLVPYP 722

  Fly  2085 DQCGQLFVKCGFSELTGRIEGQI---HRCPQGFAYWNVSRRC-EPARKLPNCTPTTYNV 2139
            ..|.: ::.|         |..|   :.||:|..:..:...| :|  .|..|.|:..::
  Fly   723 GNCSK-YIAC---------EDPIPVGYACPEGEEFNPIILTCTDP--HLAGCNPSALHI 769

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884 11/61 (18%)
CBM_14 1336..1388 CDD:279884 12/52 (23%)
CBM_14 1523..1577 CDD:279884 15/63 (24%)
VAD1-2 <1599..>1656 CDD:291956 5/57 (9%)
CBM_14 1809..1861 CDD:279884 11/53 (21%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884 11/63 (17%)
CBM_14 136..182 CDD:279884 14/69 (20%)
CBM_14 207..261 CDD:279884 13/67 (19%)
CBM_14 293..347 CDD:279884 18/118 (15%)
CBM_14 367..421 CDD:279884 13/68 (19%)
CBM_14 470..522 CDD:279884 14/60 (23%)
CBM_14 544..597 CDD:279884 9/57 (16%)
CBM_14 630..678 CDD:279884 13/62 (21%)
CBM_14 710..758 CDD:279884 13/60 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.