DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mur89F and CG33985

Sequence 1:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_001034018.1 Gene:CG33985 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster

Alignment Length:268 Identity:60/269 (22%)
Similarity:87/269 (32%) Gaps:58/269 (22%)


  Fly  1812 FFPDPEDCSRYYRCVDAAKNGKYQVYAFKCGKGTVWDTSTETCNYADQVSGNCSSGQTTTPGTTT 1876
            |...|:.|:.|..|     ||. :.|..:|..|..:....|.|.....:  :|.:|.......||
  Fly    36 FVTSPKSCAHYIFC-----NGD-ESYDGECEDGEYFSQDMEMCEPMGDI--DCRTGSEVQRENTT 92

  Fly  1877 EPGTTESTTSSGKPETTSKAPENTTTWAPETTTTSSPETTTTVASETTTTTSG---TTTTATPET 1938
            :..:||.|:.|....|..     .||.||....|..|....:.||.||:.:..   ..|...|:.
  Fly    93 DSSSTEITSESSTISTVV-----ITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVCPQL 152

  Fly  1939 TTK------------------------PPKPETTTIAGEETSTSKSPTTTESPAPSTNTSAPCPE 1979
            ..:                        |....|:......|.....|......|.:.|....|..
  Fly   153 DNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKCDHPENVRCLAMTYNPREQCKR 217

  Fly  1980 TGPGQNVYVCPTGFRRHPEKCGMFYQCSESADNNDLNIVVFQCP--NGTVYQDKSC-SCGKPPAG 2041
                ..:.|.|     |.:.|..||||...      .::|.|||  .|..|:.:|| :.|:....
  Fly   218 ----HVIDVYP-----HSDNCNYFYQCRSG------YLMVQQCPFFYGWDYEKRSCVALGQAKCY 267

  Fly  2042 DKCSKDMK 2049
            :|....||
  Fly   268 NKLQMQMK 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884 12/49 (24%)
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 12/44 (27%)
CBM_14 160..202 CDD:279884 4/42 (10%)
ChtBD2 215..259 CDD:214696 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.