DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mur89F and Chi3l3

Sequence 1:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:XP_008759605.1 Gene:Chi3l3 RGDID:1308790 Length:401 Species:Rattus norvegicus

Alignment Length:106 Identity:25/107 (23%)
Similarity:44/107 (41%) Gaps:31/107 (29%)


  Fly   155 RTYASTHRLPTNYGL-AGLNGVSVISFSSSSSLRAVGSAEEDGIICRDDGF--------MTDPSD 210
            |..:..::.|::.|: |.||..::||:...:     |:|.|..|:    ||        ::|||:
  Rat   223 RENSPLYQSPSDTGIYAYLNVDAIISYWKDN-----GAAREKLIV----GFPAYGHNFILSDPSN 278

  Fly   211 CTVFYRCISNGR-----------GYNKIGFRCSDGTA--WD 238
            ..:....:|.|.           .|.:|....:||..  ||
  Rat   279 TGINAPIVSTGPPGKFTGEAGLWAYYEICTFLNDGATDLWD 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884 13/61 (21%)
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
Chi3l3XP_008759605.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 25/107 (23%)
Glyco_18 26..365 CDD:214753 25/107 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.