DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mur89F and lmd-5

Sequence 1:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_001309512.1 Gene:lmd-5 WormBaseID:WBGene00020141 Length:1518 Species:Caenorhabditis elegans

Alignment Length:166 Identity:37/167 (22%)
Similarity:63/167 (38%) Gaps:23/167 (14%)


  Fly   171 GLNGVSVISFSSSSSLRAVG--SAEEDGIICRDDGFMTDPSDCTVFYRCISNGRGYNKIGFRCSD 233
            |..|:.:.|.:..:..| ||  :.:|..::.|::....|..|..|..||.|.....|....:...
 Worm   824 GFEGIKIFSETFDAPKR-VGCDAGKEAAVVIRNERTCRDDQDRDVERRCWSGDDMMNWEFLQLEW 887

  Fly   234 GTAWDE-----SLQSCNHM--------FDVRANGGCRNQA------VPQNDGYYAGQTSTQSSQT 279
            |.|:..     :|..|..:        ||| ..|..:|:.      ..:|||.|.|....:..|.
 Worm   888 GFAFKPKPFGGTLFVCEFIDRHEQKIGFDV-YGGKSKNKGKNTFYYAVRNDGIYFGTEKYKEDQL 951

  Fly   280 SYQNSTTSSQQSSSTSSSNSSQSSSSTSSSTSNSSS 315
            .........:...|...|:::.|:..|.||:..::|
 Worm   952 MGSWDNVCEEDKESEDDSSTADSAEPTGSSSVPAAS 987

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884 14/63 (22%)
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
lmd-5NP_001309512.1 LysM 22..65 CDD:197609
LysM 77..120 CDD:197609
LysM 151..194 CDD:197609
LysM 220..260 CDD:197609
LysM 275..312 CDD:197609
LysM 386..429 CDD:197609
Self-incomp_S1 851..944 CDD:283566 22/94 (23%)
Glyco_18 991..1336 CDD:214753
GH18_chitinase-like 992..1336 CDD:299167
ChtBD1_GH18_2 1388..1435 CDD:211315
ChtBD1_GH18_2 1462..1513 CDD:211315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.