DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mur89F and CG42728

Sequence 1:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_001189111.1 Gene:CG42728 FlyBaseID:FBgn0261681 Length:156 Species:Drosophila melanogaster

Alignment Length:126 Identity:35/127 (28%)
Similarity:55/127 (43%) Gaps:12/127 (9%)


  Fly   951 SSNQGSSSNQGSSSNQGSSSNQGSSS-----NQGSSSNQSSSSNQSSSNQSSSNQSSSSN-QTSS 1009
            |...|..:|..|:.|....:..|.:|     |...::|.:.|......|.::...|::.| .|::
  Fly    32 SGQNGFINNTRSNCNYSLINCSGQNSMFCTDNTTCNANFTCSDILPVDNSTALPISTTPNVVTTA 96

  Fly  1010 STTQKPFKPAEKCESEET-FLADNENCSKFYRCVDNGKGGFTKVSFTCPPNTLWDPEANSC 1069
            |||..|.....:|....| ..:..:||:.||.|||    ||..|. .||....:||:..:|
  Fly    97 STTVSPSDIRRECRQGVTKRFSYPQNCNYFYYCVD----GFLLVE-QCPIGYAFDPQTGAC 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884 16/47 (34%)
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
CG42728NP_001189111.1 CBM_14 117..152 CDD:279884 14/40 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.