DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5246 and Jon25Bi

Sequence 1:NP_650603.1 Gene:CG5246 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster

Alignment Length:286 Identity:90/287 (31%)
Similarity:128/287 (45%) Gaps:37/287 (13%)


  Fly     1 MKCLVLISVLVILSQCSAKSV-KIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSI-MNTF 63
            ||..|:::  :.|:..||::| ::|.:....    ..|...|::.|..:..|.|||.|.: .:..
  Fly     1 MKVFVVLA--LALAAVSAETVQQVHPKDLPK----DTKINGRIVNGYPAYEGKAPYTVGLGFSGN 59

  Fly    64 GEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYH-ND 127
            |...|||||||..|:||||||.....| :.|..|....|.....:.|.......:|:.|..: ||
  Fly    60 GGWWCGGSIIAHDWVLTAAHCTNGASQ-VTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGND 123

  Fly   128 IALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTL--------TGWGSTKTWGRYSTQLQKIDL 184
            ||||.|.....:       .:.:|..||...|:..:        .|||.| |.|.....::.:||
  Fly   124 IALIRTPHVDFW-------HMVNKVELPSFNDRYNMYDNYWAVACGWGLT-TAGSQPDWMECVDL 180

  Fly   185 NYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV--DANQTLVGVVNW--GEACAI 245
            ..|.:..|.   |......:|.:|..|..|:.:|.||||||||  |..: ||||.:|  |..|..
  Fly   181 QIISNSECS---RTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGR-LVGVTSWVSGNGCTA 241

  Fly   246 GYPDVFGSVAYYHDWIEQMMTDAGTA 271
            |.|..|..|....|||..   ::|.|
  Fly   242 GLPSGFTRVTNQLDWIRD---NSGVA 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 78/234 (33%)
Tryp_SPc 42..263 CDD:238113 78/235 (33%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 78/234 (33%)
Tryp_SPc 37..260 CDD:238113 78/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50844
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24260
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.