DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5246 and Klk15

Sequence 1:NP_650603.1 Gene:CG5246 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002728805.2 Gene:Klk15 RGDID:1310995 Length:315 Species:Rattus norvegicus

Alignment Length:305 Identity:80/306 (26%)
Similarity:127/306 (42%) Gaps:92/306 (30%)


  Fly    39 ETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYL---------KI 94
            ::||:||........|:||:::|   |.:|||.:|.|.|::|||||  :.|.||         |:
  Rat    22 QSRVVGGFKCEKNSQPWQVAVIN---EDLCGGVLIDPSWVITAAHC--YKIFYLYLSTAQDGDKV 81

  Fly    95 VTG--TVDYTRP-----------------------------------------------GAEYLV 110
            :.|  .|.:::|                                               |.|.|.
  Rat    82 LEGEECVPHSQPWQVALFERGRFNCGAFLISPHWVLTAAHCQTRFMRVRLGEHNLRKFDGPEQLR 146

  Fly   111 DGSKI--HCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWG-----S 168
            ..|:|  |..::...:.:||.|:...:|.......:|:.|.::  .|.:|:...::|||     |
  Rat   147 SVSRIIPHPGYEARTHRHDIMLLRLFRPARLTPQVRPVALPTR--CPLLGEDCVVSGWGLLSDNS 209

  Fly   169 TKTWGRYSTQLQKID------LNYIDHDNCQSRVRNANW---LSEGHVCTFTQEGEG--SCHGDS 222
            ....|.:.:|::..|      ::.|...:|     |.::   :....||... ||.|  ||.|||
  Rat   210 PGATGSHKSQVRLPDTLHCANISIISEASC-----NKDYPGRVLPTMVCAGV-EGGGTDSCEGDS 268

  Fly   223 GGPLVDANQTLVGVVNWGEA-C-AIGYPDVFGSVAYYHDWIEQMM 265
            ||||| ....|.|:|:||:. | ....|.|:..|..|.|||.:.|
  Rat   269 GGPLV-CGGALQGIVSWGDVPCDTTTKPGVYTKVCSYMDWIRKNM 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 78/298 (26%)
Tryp_SPc 42..263 CDD:238113 78/299 (26%)
Klk15XP_002728805.2 Tryp_SPc 84..311 CDD:238113 55/236 (23%)
Tryp_SPc 84..308 CDD:214473 54/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.