DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5246 and svh-1

Sequence 1:NP_650603.1 Gene:CG5246 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans

Alignment Length:264 Identity:78/265 (29%)
Similarity:128/265 (48%) Gaps:20/265 (8%)


  Fly    14 SQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE-HVCGGSIIAPQW 77
            |||..:.|:::.|......:      .||:||.::..|..|:..::.|...: |.||.||:....
 Worm   691 SQCGLRYVEVNARDAAKSRI------ARVVGGFETVPGAFPWTAALRNKATKAHHCGASILDKTH 749

  Fly    78 ILTAAHCMEWP--IQYLKIVTGTVDYTR-PGAEYLVDGSKIH-CSHDKPAYHNDIALIHTAKP-I 137
            ::|||||.|..  :...::|.|..|..: .|.|.:....:|| ....|..:.:|||::....| |
 Worm   750 LITAAHCFEEDERVSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIFSHDIAILEIPYPGI 814

  Fly   138 VYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWL 202
            .:::..|||.|.||..:...|.:..::||||...  ||:.:||...:..|:..:|.:..:..:.:
 Worm   815 EFNEYAQPICLPSKDFVYTPGRQCVVSGWGSMGL--RYAERLQAALIPIINRFDCVNSSQIYSSM 877

  Fly   203 SEGHVCT-FTQEGEGSCHGDSGGPLV----DANQTLVGVVNWGEACA-IGYPDVFGSVAYYHDWI 261
            |....|. :.:.|..||.||||||..    |....|.||::||:.|| ...|.::..||.|..||
 Worm   878 SRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWI 942

  Fly   262 EQMM 265
            ..::
 Worm   943 SAII 946

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 72/232 (31%)
Tryp_SPc 42..263 CDD:238113 72/233 (31%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:295335
Tryp_SPc 712..942 CDD:214473 72/232 (31%)
Tryp_SPc 713..945 CDD:238113 72/234 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.