DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and AT5G02980

DIOPT Version :10

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_195918.1 Gene:AT5G02980 / 831482 AraportID:AT5G02980 Length:335 Species:Arabidopsis thaliana


Alignment Length:153 Identity:39/153 - (25%)
Similarity:64/153 - (41%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 VVVNRLLYAIGGFDGNERLASVE-----CYH--------------PENNEWSFLP-PLQTGR-SG 516
            ::.:|.|||.     ..|:...|     |.:              |..||...|| ||.|.. :.
plant    47 LIASRELYAT-----RSRIGKTERFLYICLNLTKSNPKYRWFTLPPVPNEQKLLPVPLFTYHLNS 106

  Fly   517 AGVAAINQYIYVVGGFDGTRQLATVERYDTENDTWDMVAPIQIARSALSLTPLDEKLYAIGGFDG 581
            :.|::.:..||::||.....:......:|..:.....:..::..|::.:...:|.|:|.|||.:.
plant   107 STVSSTDSEIYIIGGLVWGNRSKKASIFDCRSHQTRRLPKMRFPRASAAAHVIDGKIYVIGGGEI 171

  Fly   582 NNFLSIVEVYDPRTNTWTTGTPL 604
            ..     |||||.|.||.| ||:
plant   172 RG-----EVYDPTTQTWLT-TPV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 PHA03098 92..599 CDD:222983 35/146 (24%)
KELCH repeat 369..416 CDD:276965
KELCH repeat 420..463 CDD:276965
KELCH repeat 467..510 CDD:276965 12/56 (21%)
KELCH repeat 514..558 CDD:276965 6/44 (14%)
KELCH repeat 561..606 CDD:276965 18/44 (41%)
AT5G02980NP_195918.1 F-box_AtAFR-like 14..57 CDD:438923 4/14 (29%)
NanM 81..>190 CDD:442289 32/114 (28%)
KELCH repeat 99..148 CDD:276965 8/48 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.