DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and AT4G19870

DIOPT Version :10

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_193722.2 Gene:AT4G19870 / 827733 AraportID:AT4G19870 Length:400 Species:Arabidopsis thaliana


Alignment Length:95 Identity:32/95 - (33%)
Similarity:46/95 - (48%) Gaps:13/95 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 AINQYIYVVGG-FDGTRQLATVERYDTENDTWDMVAPIQIARSALSLTPLDEKLYAIGGFDGNNF 584
            |:...|||:|| .||....| |...|..::||.....:.:||....:...|.|:|.|||:   |.
plant   142 AVGSEIYVIGGKVDGALSSA-VRILDCRSNTWRDAPSMTVARKRPFICLYDGKIYVIGGY---NK 202

  Fly   585 LS----IVEVYDPRTNTW----TTGTPLKS 606
            ||    ..||:|.:|.||    ..||.:::
plant   203 LSESEPWAEVFDIKTQTWECLSDPGTEIRN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 PHA03098 92..599 CDD:222983 30/86 (35%)
KELCH repeat 369..416 CDD:276965
KELCH repeat 420..463 CDD:276965
KELCH repeat 467..510 CDD:276965
KELCH repeat 514..558 CDD:276965 13/37 (35%)
KELCH repeat 561..606 CDD:276965 18/52 (35%)
AT4G19870NP_193722.2 F-box_AtAFR-like 35..73 CDD:438923
NanM 139..>264 CDD:442289 32/95 (34%)
KELCH repeat 139..178 CDD:276965 13/36 (36%)
KELCH repeat 182..227 CDD:276965 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.