DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and AT3G24610

DIOPT Version :10

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_001319634.1 Gene:AT3G24610 / 822057 AraportID:AT3G24610 Length:375 Species:Arabidopsis thaliana


Alignment Length:103 Identity:28/103 - (27%)
Similarity:45/103 - (43%) Gaps:15/103 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 PPLQTGRSGAGVAAINQYIYVV------------GGFDGTRQLATVERYDTENDTWDMVAPIQIA 560
            |.|...||..|.|  .:::||.            ...:|.|.| .|...|..:..|..|..:::|
plant    65 PELYQTRSLIGYA--EKFLYVCFCMPTDETLCCHEKINGNRSL-NVLFLDCRSHKWHHVTSMRVA 126

  Fly   561 RSALSLTPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTW 598
            |.:..::.:|.|:...||....::....||:||:|.||
plant   127 RVSPEVSVVDGKINVWGGCKYKHYYDWGEVFDPKTQTW 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 PHA03098 92..599 CDD:222983 28/103 (27%)
KELCH repeat 369..416 CDD:276965
KELCH repeat 420..463 CDD:276965
KELCH repeat 467..510 CDD:276965 1/1 (100%)
KELCH repeat 514..558 CDD:276965 13/55 (24%)
KELCH repeat 561..606 CDD:276965 12/38 (32%)
AT3G24610NP_001319634.1 F-box_AtAFR-like 30..71 CDD:438923 2/5 (40%)
NanM <106..>181 CDD:442289 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.