DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and KLHL1

DIOPT Version :8

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_065917.1 Gene:KLHL1 / 57626 HGNCID:6352 Length:748 Species:Homo sapiens

Alignment Length:617 Identity:214/618 (35%)
Similarity:334/618 (54%) Gaps:22/618 (4%)


  Fly    19 PNHKGYPCRPEEAEMSNTSESCSISCGGRFGS-AHSTL--DDHDATDDDMTFCMSNYAKEALKMM 80
            |:.||...:..:.|..|:|::....||.|..| .||..  .|.|::..:..:...::|::..:.|
Human   138 PHEKGLVLQELKVEPDNSSQATGEGCGHRLSSTGHSMTPQSDLDSSSSEEFYQAVHHAEQTFRKM 202

  Fly    81 YMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGVCPTAMSRIL 145
            ........|.||:|.|.....|||::|||:.|.||.||||..:.|::...::::|:.|.|:..::
Human   203 ESYLKQQQLCDVILIVGNRKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLV 267

  Fly   146 YFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVELQKK 210
            .|.|||.:.:.|.|:..||.||.:.|:|.|::.||.||.:.|.|:|.:||..||:..||:||.|.
Human   268 QFAYTGCLELKEDTIENLLAAACLLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKV 332

  Fly   211 ANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNVQEEREVYNAVLKWVKYDEDNRHCKMEHI 275
            |:.:...|..:|.:.:|||.|.|.:|..|:..|::||.:|..:::|::.|||||..:|...:..:
Human   333 AHSYTMENIMEVIRNQEFLLLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQSRCNDLSML 397

  Fly   276 LGAVRCQFLTPNFLKEQMKNCDVLRKVPACREYLAKIFK------DLTLHKCPGVKERTPNTTRM 334
            |..:|...|.|..|.: ::|..:.:....|::.:.:..|      ..||.:.|..|.| .:|...
Human   398 LAFIRLPLLPPQILAD-LENHALFKNDLECQKLILEAMKYHLLPERRTLMQSPRTKPR-KSTVGT 460

  Fly   335 IFVAGGFFRH-SLDILEAYNVDDMTWTTLANLRIPRSGLGAAFLKGKFYAVGGRNNNIGSSYDSD 398
            ::..||...: ....:|.|::....|.....:...|...|.|.:..|.:.:|||:    .....:
Human   461 LYAVGGMDNNKGATTIEKYDLRTNLWIQAGMMNGRRLQFGVAVIDDKLFVIGGRD----GLKTLN 521

  Fly   399 WVDRYSAVTETWRPCAPMSVPRHRVGVAVMDELMYAVGGSAGMEYHNTVEYYDPDLDRWTLVQPM 463
            .|:.|:..|:||....|||..||.:||.|::..:|||||..|..|.||||.:||...:||.|..|
Human   522 TVECYNPKTKTWTVLPPMSTHRHGLGVTVLEGPIYAVGGHDGWSYLNTVERWDPQSQQWTFVASM 586

  Fly   464 HAKRLGVGVVVVNRLLYAIGGFDGNERLASVECYHPENNEWSFLPPLQTGRSGAGVAAINQYIYV 528
            ...|..|||..:|..||::||.||:..|:|:|.|.|..|:|:...|:...|.|.|||..:.::|.
Human   587 SIARSTVGVAALNGKLYSVGGRDGSSCLSSMEYYDPHTNKWNMCAPMCKRRGGVGVATCDGFLYA 651

  Fly   529 VGGFDG------TRQLATVERYDTENDTWDMVAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSI 587
            |||.|.      :|.|..|||||.:.|||.||||:.:.|.|:.:..|.::|||:||:||..:|:.
Human   652 VGGHDAPASNHCSRLLDYVERYDPKTDTWTMVAPLSMPRDAVGVCLLGDRLYAVGGYDGQTYLNT 716

  Fly   588 VEVYDPRTNTWTTGTPLKSGRSGHASAVIYQP 619
            :|.|||:||.||....|..||:|....||.||
Human   717 MESYDPQTNEWTQMASLNIGRAGACVVVIKQP 748

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 BTB 80..183 CDD:279045 39/103 (38%)
PHA03098 92..599 CDD:222983 187/520 (36%)
BACK 192..294 CDD:285009 35/102 (34%)
Kelch 335..379 CDD:128874 8/45 (18%)
KELCH repeat 369..416 CDD:276965 13/47 (28%)
Kelch 382..430 CDD:128874 16/48 (33%)
KELCH repeat 420..463 CDD:276965 21/43 (49%)
Kelch 433..476 CDD:128874 21/43 (49%)
KELCH repeat 467..510 CDD:276965 19/43 (44%)
Kelch 478..523 CDD:128874 19/45 (42%)
KELCH repeat 514..558 CDD:276965 24/50 (48%)
Kelch_1 514..556 CDD:279660 23/48 (48%)
KELCH repeat 561..606 CDD:276965 20/45 (44%)
Kelch 572..616 CDD:128874 21/44 (48%)
KLHL1NP_065917.1 BTB 202..305 CDD:279045 39/103 (38%)
PHA03098 206..728 CDD:222983 189/528 (36%)
BACK 314..413 CDD:285009 35/99 (35%)
Kelch 1 460..506 8/46 (17%)
Kelch 461..506 CDD:128874 8/45 (18%)
Kelch_1 495..540 CDD:279660 14/49 (29%)
KELCH repeat 496..539 CDD:276965 13/47 (28%)
Kelch 2 507..553 17/50 (34%)
KELCH repeat 543..587 CDD:276965 22/44 (50%)
Kelch 555..600 CDD:128874 22/45 (49%)
Kelch 3 555..600 22/45 (49%)
KELCH repeat 590..633 CDD:276965 19/43 (44%)
Kelch 601..647 CDD:128874 19/46 (41%)
Kelch 4 601..647 19/46 (41%)
KELCH repeat 637..687 CDD:276965 24/50 (48%)
Kelch 649..700 CDD:128874 22/51 (43%)
Kelch 5 649..700 22/51 (43%)
KELCH repeat 690..734 CDD:276965 20/44 (45%)
Kelch 6 701..747 22/46 (48%)
Kelch 701..745 CDD:128874 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312716at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.