DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and KLHL8

DIOPT Version :8

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_001278932.1 Gene:KLHL8 / 57563 HGNCID:18644 Length:620 Species:Homo sapiens

Alignment Length:610 Identity:188/611 (31%)
Similarity:317/611 (52%) Gaps:46/611 (8%)


  Fly    53 STLDDHDATDDDMTFCMSNYAKEALKMMY--MMR--SHGMLTDVVLEVKKELFPAHKVVLSAASP 113
            |::.|.|. :|...|    .|.||.|..:  ::|  .:|.|.||.|:|..:|...||:||:...|
Human    31 SSISDGDG-EDSFIF----EANEAWKDFHGSLLRFYENGELCDVTLKVGSKLISCHKLVLACVIP 90

  Fly   114 YFKAMFTGGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDA 178
            ||:|||...:.|::.:.::::.....|:..::.|:|:.::.:|...|..||.||.:.||..|..|
Human    91 YFRAMFLSEMAEAKQTLIEIRDFDGDAIEDLVKFVYSSRLTLTVDNVQPLLYAACILQVELVARA 155

  Fly   179 CCAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRD 243
            ||.:::....|:|.:.:..|||.|..::|...|:.:...:||:|.:.|:|:.:|...|..|:...
Human   156 CCEYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYACDHFTEVVECEDFVSVSPQHLHKLLSSS 220

  Fly   244 ELNVQEEREVYNAVLKWVKYDEDNRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLRKVPACREY 308
            :||::.|::||||.:||:..:..:....::..|..||...|..:||...:....::::...||:.
Human   221 DLNIENEKQVYNAAIKWLLANPQHHSKWLDETLAQVRLPLLPVDFLMGVVAKEQIVKQNLKCRDL 285

  Fly   309 LAKIFKDLTLH----KCPGVK---ERTP--NTTRMIFVAGGF------FRHSLDILEAYNVDDMT 358
            |.:. ::..||    ..|..:   ..||  :|..::|..||.      ||.    :|.|:::..:
Human   286 LDEA-RNYHLHLSSRAVPDFEYSIRTTPRKHTAGVLFCVGGRGGSGDPFRS----IECYSINKNS 345

  Fly   359 WTTLANLRIPRSGLGAAFLKGKFYAVGGR--NNNIGSSYDSDWVDRYSAVTETWRPCAPMSVPRH 421
            |.....:...|..:|...::||.|||||.  |.::||      ::.:..:|..|...|.|:..|.
Human   346 WFFGPEMNSRRRHVGVISVEGKVYAVGGHDGNEHLGS------MEMFDPLTNKWMMKASMNTKRR 404

  Fly   422 RVGVAVMDELMYAVGGSAGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFD 486
            .:.:|.:...:||:||.......|.||.||.:.|:|:.|.||:..|.|||.|.:...:||:||.|
Human   405 GIALASLGGPIYAIGGLDDNTCFNDVERYDIESDQWSTVAPMNTPRGGVGSVALVNHVYAVGGND 469

  Fly   487 GNERLASVECYHPENNEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLATVERYDTENDTW 551
            |...|:|||.|.|..::|..:..:...|:|.||:.::..:|||||||....|::|||||..::.|
Human   470 GMASLSSVERYDPHLDKWIEVKEMGQRRAGNGVSKLHGCLYVVGGFDDNSPLSSVERYDPRSNKW 534

  Fly   552 DMVAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTTGTPLKSGRSGHASAVI 616
            |.||.:...|..:.:..:..|::|:||.:||.:|:.||.:||..|.|.....:...|:|...||.
Human   535 DYVAALTTPRGGVGIATVMGKIFAVGGHNGNAYLNTVEAFDPVLNRWELVGSVSHCRAGAGVAVC 599

  Fly   617 YQPACSTTFMDYEDSDAPHPDGSNN 641
               :|.|:    :..|..|  ||||
Human   600 ---SCLTS----QIRDVGH--GSNN 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 BTB 80..183 CDD:279045 34/107 (32%)
PHA03098 92..599 CDD:222983 163/524 (31%)
BACK 192..294 CDD:285009 29/102 (28%)
Kelch 335..379 CDD:128874 10/50 (20%)
KELCH repeat 369..416 CDD:276965 15/49 (31%)
Kelch 382..430 CDD:128874 14/50 (28%)
KELCH repeat 420..463 CDD:276965 15/43 (35%)
Kelch 433..476 CDD:128874 19/43 (44%)
KELCH repeat 467..510 CDD:276965 18/43 (42%)
Kelch 478..523 CDD:128874 17/45 (38%)
KELCH repeat 514..558 CDD:276965 21/44 (48%)
Kelch_1 514..556 CDD:279660 21/42 (50%)
KELCH repeat 561..606 CDD:276965 14/45 (31%)
Kelch 572..616 CDD:128874 17/44 (39%)
KLHL8NP_001278932.1 BTB 57..161 CDD:279045 34/104 (33%)
PHA03098 60..535 CDD:222983 149/486 (31%)
BACK 169..271 CDD:285009 29/102 (28%)
Kelch 319..366 CDD:128874 10/51 (20%)
Kelch 1 319..366 10/51 (20%)
KELCH repeat 356..399 CDD:276965 15/49 (31%)
Kelch 367..413 CDD:128874 15/52 (29%)
Kelch 2 367..413 15/52 (29%)
KELCH repeat 403..447 CDD:276965 16/44 (36%)
Kelch 3 415..460 19/45 (42%)
Kelch 415..458 CDD:128874 19/43 (44%)
KELCH repeat 450..495 CDD:276965 18/45 (40%)
Kelch 461..502 CDD:128874 16/41 (39%)
Kelch 4 462..507 17/45 (38%)
KELCH repeat 497..542 CDD:276965 21/45 (47%)
Kelch 508..554 CDD:128874 18/46 (39%)
Kelch 5 508..554 18/46 (39%)
KELCH repeat 544..586 CDD:276965 14/42 (33%)
Kelch 555..599 CDD:128874 17/44 (39%)
Kelch 6 556..601 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312716at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.