DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and klhl5

DIOPT Version :8

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_001164413.1 Gene:klhl5 / 560697 ZFINID:ZDB-GENE-080424-7 Length:769 Species:Danio rerio

Alignment Length:638 Identity:221/639 (35%)
Similarity:335/639 (52%) Gaps:50/639 (8%)


  Fly     1 MQTQMHSPMQ--YETHISDMPNHKGYPCRPEEAEMSNTSESCSISCGGRFGSAHSTLDDHDATD- 62
            :|.|...|.|  .:...:..|:..|    |.:.|.:|..||.|.||  |..::..||....:.: 
Zfish   146 LQQQPQQPQQQPQKQQSTRAPDASG----PGDEENNNNVESDSSSC--RTSNSSVTLSSCASMEP 204

  Fly    63 --DDMTFCMSNYAKEALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKE 125
              .|..|...::|:...:.|........|.||||.......|||::|||:.|.||.||||..::|
Zfish   205 CVSDEHFQAHSHAEHTFRRMEAYLRTRKLCDVVLLAGDRRIPAHRLVLSSVSDYFAAMFTSDVRE 269

  Fly   126 SEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPT 190
            ::...::::||.|.|:..::.:.|||::.:.|.|:..||..:.:.|:..|:.|||::|.:||.|:
Zfish   270 AKQEEIKMEGVDPDALWVLVQYAYTGRLELREDTIESLLSGSCLLQLSAVVQACCSYLMKQLHPS 334

  Fly   191 NAIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNVQEEREVYN 255
            |.:||..||:..||::|.|.|:.:...:|.:|.:.:|||.|.:.::..|:..|::||.||..|..
Zfish   335 NCLGIRSFADAQGCLDLHKVAHNYTMEHFMEVMRHQEFLLLPSCEVEKLLASDDMNVPEEETVVT 399

  Fly   256 AVLKWVKYDEDNRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLRKVPACREYLAKIFKDLTLHK 320
            |:|.||::|...|..::..:|..:|...|.|.||.:...| .:||....|:..:.:..|   .|.
Zfish   400 ALLSWVRHDVTTRQSQLSALLAHIRLPLLKPQFLADMEAN-PLLRDSVECQRLVMEAMK---YHL 460

  Fly   321 CPGVKERTP-----------NTTRMIFVAGGFFRHSLDI------LEAYNVDDMTWTTLANLRIP 368
            .|   ||.|           .|...:|..||     :|.      :|.|.:...||..:|.:...
Zfish   461 LP---ERRPLLQSPRTRPRKATVGALFAVGG-----MDATKGATSIEQYCLRRDTWRQVAVMSGR 517

  Fly   369 RSGLGAAFLKGKFYAVGGRNNNIGSSYDSDWVDRYSAVTETWRPCAPMSVPRHRVGVAVMDELMY 433
            |...|.|.|..:.|.||||:    .....:.|:.|:..:::|....|||..||.:||||::..||
Zfish   518 RLQFGVAVLDDRLYVVGGRD----GLKTLNTVECYNPRSKSWSVMPPMSTHRHGLGVAVLEGPMY 578

  Fly   434 AVGGSAGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFDGNERLASVECYH 498
            ||||..|..|.:|||.:||...:|:.|..|...|..|||.|:|..|||:||.||:..|.||||:.
Zfish   579 AVGGHDGWSYLSTVERWDPQARQWSFVASMATPRSTVGVAVLNSKLYAVGGRDGSSCLKSVECFD 643

  Fly   499 PENNEWSFLPPLQTGRSGAGVAAINQYIYVVGGFD------GTRQLATVERYDTENDTWDMVAPI 557
            |..|:||...|:...|.|.|||..|.::|.:||.|      .:|....|||||.:.|.|..|||:
Zfish   644 PHTNKWSSCAPMSKRRGGVGVATWNGFLYAIGGHDAPASSLASRLSDCVERYDPKTDMWTAVAPM 708

  Fly   558 QIARSALSLTPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTTGTPLKSGRSG 610
            .::|.|:.:..|.::|||:||:||..:|:.||.|||:||.||...||..||:|
Zfish   709 SLSRDAVGVCLLGDRLYAVGGYDGQVYLNTVEAYDPQTNEWTQVAPLCLGRAG 761

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 BTB 80..183 CDD:279045 36/103 (35%)
PHA03098 92..599 CDD:222983 192/530 (36%)
BACK 192..294 CDD:285009 34/102 (33%)
Kelch 335..379 CDD:128874 13/50 (26%)
KELCH repeat 369..416 CDD:276965 13/47 (28%)
Kelch 382..430 CDD:128874 17/48 (35%)
KELCH repeat 420..463 CDD:276965 21/43 (49%)
Kelch 433..476 CDD:128874 20/43 (47%)
KELCH repeat 467..510 CDD:276965 23/43 (53%)
Kelch 478..523 CDD:128874 22/45 (49%)
KELCH repeat 514..558 CDD:276965 21/50 (42%)
Kelch_1 514..556 CDD:279660 20/48 (42%)
KELCH repeat 561..606 CDD:276965 22/45 (49%)
Kelch 572..616 CDD:128874 22/40 (55%)
klhl5NP_001164413.1 BTB 224..327 CDD:279045 36/103 (35%)
PHA03098 225..756 CDD:222983 197/547 (36%)
BACK 336..435 CDD:285009 34/99 (34%)
Kelch 483..528 CDD:128874 13/50 (26%)
KELCH repeat 518..561 CDD:276965 13/47 (28%)
Kelch 529..575 CDD:128874 17/50 (34%)
KELCH repeat 565..609 CDD:276965 22/44 (50%)
Kelch 578..621 CDD:128874 20/43 (47%)
KELCH repeat 612..655 CDD:276965 23/43 (53%)
Kelch 623..669 CDD:128874 23/46 (50%)
KELCH repeat 659..709 CDD:276965 21/50 (42%)
Kelch 671..722 CDD:128874 18/51 (35%)
KELCH repeat 712..755 CDD:276965 21/43 (49%)
Kelch 723..767 CDD:128874 22/40 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312716at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.