DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and KLHL18

DIOPT Version :8

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_001262494.1 Gene:KLHL18 / 41458 FlyBaseID:FBgn0037978 Length:575 Species:Drosophila melanogaster

Alignment Length:568 Identity:204/569 (36%)
Similarity:305/569 (54%) Gaps:55/569 (10%)


  Fly    55 LDDHDATDDDMTFCMSNYAK---EALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFK 116
            |.|:...:|.  :.:..:.|   |:..:...:|..|.|.||.|:|:.:.|.||:|||:|..|||.
  Fly     3 LSDNSQVEDQ--YFVYKHDKLFGESFPLFKEIRRMGKLCDVTLKVEDQTFSAHRVVLAATIPYFY 65

  Fly   117 AMFTGGLKESEMSRVQLQ--GVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDAC 179
            ||||..:.||.:..:.::  .:.|:|:..::.::|:||:|:....|..|:..|:..|:.||.|||
  Fly    66 AMFTNNMAESRIKEITMKESAIEPSALESLINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDAC 130

  Fly   180 CAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDE 244
            .:||..:..|.|.:||..||:...|.:|...|:.:|::||.:|.|.||||.|...||:.|:||||
  Fly   131 ASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDE 195

  Fly   245 LNVQEEREVYNAVLKWVKYDEDNRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLRKVPACREYL 309
            |||:.|..::.|.:|||||.||.|......:|.|||...|:|.||.:::...:::|....||:.|
  Fly   196 LNVRTEEVIFEACMKWVKYAEDKRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLL 260

  Fly   310 --AKIFKDLTLHKCPGVKERTPNTTRMIFVAGGFFRHSLDILEAYNVDDMTWTTLANLRIPRSGL 372
              ||.|     |..|   ||.                  .:|:::....            ||| 
  Fly   261 DEAKDF-----HLMP---ERR------------------GLLQSFRTRQ------------RSG- 286

  Fly   373 GAAFLKGKFYAVGGRNNNIGSSYDS-DWVDRYSAVTETWRPCAPMSVPRHRVGVAVMDELMYAVG 436
              .|..|:.|||||    :.|:.:| ..|:.|..:|:.|:....||:.|.||||||::..:||.|
  Fly   287 --EFFTGQIYAVGG----LASTGESVSTVEIYDPLTKKWKMGEQMSMMRSRVGVAVLNGKLYAFG 345

  Fly   437 GSAGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFDGNERLASVECYHPEN 501
            |..|.|..:|||.|||..::|:....|..||..|||..::..:|..||:||...|.:||.|:|::
  Fly   346 GFNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGYDGVTSLNTVEVYYPKS 410

  Fly   502 NEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLATVERYDTENDTWDMVAPIQIARSALSL 566
            |.|..:..:...||..||..:|.|:|.:||.||.....:|||||...|.|..::|:...|..|.:
  Fly   411 NTWKTVAQMMKYRSAGGVTQLNGYVYALGGHDGLSIFDSVERYDQAEDVWVKMSPMLNRRCRLGV 475

  Fly   567 TPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTTGTPLKSGRSGHASA 614
            ..|:.|:|..||:.||:||..||.|||:|:||...||:...||..|.|
  Fly   476 ATLNGKIYVCGGYCGNSFLRSVECYDPQTDTWKLVTPMNCKRSRVALA 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 BTB 80..183 CDD:279045 39/105 (37%)
PHA03098 92..599 CDD:222983 189/512 (37%)
BACK 192..294 CDD:285009 45/102 (44%)
Kelch 335..379 CDD:128874 5/44 (11%)
KELCH repeat 369..416 CDD:276965 16/48 (33%)
Kelch 382..430 CDD:128874 20/49 (41%)
KELCH repeat 420..463 CDD:276965 20/43 (47%)
Kelch 433..476 CDD:128874 19/43 (44%)
KELCH repeat 467..510 CDD:276965 16/43 (37%)
Kelch 478..523 CDD:128874 16/45 (36%)
KELCH repeat 514..558 CDD:276965 19/44 (43%)
Kelch_1 514..556 CDD:279660 18/42 (43%)
KELCH repeat 561..606 CDD:276965 21/45 (47%)
Kelch 572..616 CDD:128874 22/44 (50%)
KLHL18NP_001262494.1 BTB 29..135 CDD:279045 40/106 (38%)
PHA03098 36..510 CDD:222983 192/519 (37%)
BACK 143..245 CDD:285009 45/102 (44%)
Kelch 292..339 CDD:128874 20/51 (39%)
KELCH repeat 329..372 CDD:276965 20/43 (47%)
Kelch 340..386 CDD:128874 19/46 (41%)
KELCH repeat 376..417 CDD:276965 16/41 (39%)
Kelch 387..433 CDD:128874 17/46 (37%)
KELCH repeat 423..466 CDD:276965 19/43 (44%)
Kelch 435..480 CDD:128874 16/45 (36%)
Kelch_1 469..514 CDD:279660 21/45 (47%)
KELCH repeat 470..514 CDD:276965 21/44 (48%)
Kelch_1 517..560 CDD:279660 4/8 (50%)
KELCH repeat 517..560 CDD:276965 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2887427
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2505
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312716at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24412
RoundUp 00.000 Not matched by this tool.
44.090

Return to query results.
Submit another query.