DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and ivns1abpa

DIOPT Version :8

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_954973.2 Gene:ivns1abpa / 387591 ZFINID:ZDB-GENE-031222-2 Length:643 Species:Danio rerio

Alignment Length:666 Identity:172/667 (26%)
Similarity:279/667 (42%) Gaps:134/667 (20%)


  Fly    63 DDMTFCMSNYAKEALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESE 127
            :|.:|..|..||     |..:|.:|...||.|:|......||:.||:..|||...:|...|:...
Zfish    10 EDESFLDSTVAK-----MNALRKNGQFCDVRLQVCGHELMAHRAVLACCSPYLFEIFNSDLEPHG 69

  Fly   128 MSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTNA 192
            :|.|:.:.:.|.|:..:|.:.||.|::..:..|.::..||...::..|...|..:|..::|..:|
Zfish    70 ISHVKFEDLDPEAVEILLNYAYTAQLKADKELVKEVYSAAKRLKMDRVKQICGDYLLSKMDSQSA 134

  Fly   193 IGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNVQEEREVYNAV 257
            |...:||...|...|..|.:.:|:.:..:|.::|:||:|...:|..:: .|.|.:....::|:.|
Zfish   135 ISYRNFASCMGDGRLLGKIDSYIQEHLLEVSEQEDFLKLPRLKLEVML-EDNLTLPSNGKLYSKV 198

  Fly   258 LKWVKYDEDNRHCKMEHILGAVRC-------QFLTPNFLKEQMK-------NCDVLRKVPACREY 308
            :.||:.........:|.::..|:.       :.|..:.|..|.:       :...::|.|. || 
Zfish   199 IGWVQRSLWENGEPLERLMEEVQTLYYSADHKLLDGSLLDGQAEVFGTEDDHIQFVQKKPP-RE- 261

  Fly   309 LAKIFKDL------------TLHKCPG-----VKERTPNTTRM---------------------- 334
              .:.:.|            |.|.|..     ..|:|.|.|.:                      
Zfish   262 --NVHRQLSTSSSGSLSPGSTKHPCKQEWKYIASEKTTNNTYLCLAVLNGMLCVIFLHGRSSPQA 324

  Fly   335 ---------------------------------------------IFVAGGFFRHS-LDILEAYN 353
                                                         :..|||:.|.. |..:|.||
Zfish   325 SPSATPCLTKSLSFEGQPLEEEPDKLLSPMHYARSGLGIASLNDQLIAAGGYNREECLRTVECYN 389

  Fly   354 VDDMTWTTLANLRIPRSGLGAAFLKGKFYAVGGRNNNIGSSYDSDWVDRYSAVTETWRPCAPMSV 418
            :...:||.:|.:|.||:....|.|.|:.|.:||.|   |.|.:....:.|:...:.|.....:..
Zfish   390 IKTNSWTFIAPMRTPRARFQMAVLMGQLYVMGGSN---GHSDELSCGETYNPNADEWTQVPELRT 451

  Fly   419 PRHRVGVAVMDELMYAVGGS--AGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLYA 481
            .|...||..::..:|.||||  .|.:.....:.:||....||...|::.:|....|..::..:|.
Zfish   452 NRCNAGVCSLNNKLYVVGGSDPCGQKGLKNCDVFDPISKAWTNCAPLNIRRHQAAVCELDGFMYV 516

  Fly   482 IGGFDGNERLASVECYHPENNEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLATVERYDT 546
            |||.:....|.|||.|:||||.|:.:..:...|.|||||.....::|||||||:..|..||.||.
Zfish   517 IGGAESWNCLNSVERYNPENNTWTLIASMNIARRGAGVAVYEGKLFVVGGFDGSHALRCVEMYDP 581

  Fly   547 ENDTWDMVAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTTGTPLKSGRSGH 611
            ..:.|.|:..:...||......|::.:|||||||||:||:.||.|:|:|..|:|           
Zfish   582 VRNEWRMLGSMNSPRSNAGAAVLNDVIYAIGGFDGNDFLNSVEAYNPKTEEWST----------- 635

  Fly   612 ASAVIYQPACSTTFMD 627
                     |:..|.|
Zfish   636 ---------CADAFTD 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 BTB 80..183 CDD:279045 29/103 (28%)
PHA03098 92..599 CDD:222983 159/608 (26%)
BACK 192..294 CDD:285009 25/109 (23%)
Kelch 335..379 CDD:128874 16/45 (36%)
KELCH repeat 369..416 CDD:276965 12/47 (26%)
Kelch 382..430 CDD:128874 11/48 (23%)
KELCH repeat 420..463 CDD:276965 14/45 (31%)
Kelch 433..476 CDD:128874 13/45 (29%)
KELCH repeat 467..510 CDD:276965 16/43 (37%)
Kelch 478..523 CDD:128874 20/45 (44%)
KELCH repeat 514..558 CDD:276965 20/44 (45%)
Kelch_1 514..556 CDD:279660 20/42 (48%)
KELCH repeat 561..606 CDD:276965 21/45 (47%)
Kelch 572..616 CDD:128874 18/44 (41%)
ivns1abpaNP_954973.2 BTB 23..634 CDD:333434 162/619 (26%)
KELCH repeat 358..401 CDD:276965 11/43 (26%)
Kelch 1 369..415 16/46 (35%)
KELCH repeat 405..450 CDD:276965 12/48 (25%)
Kelch 2 416..463 11/50 (22%)
KELCH repeat 453..498 CDD:276965 14/45 (31%)
Kelch 3 465..512 13/47 (28%)
KELCH repeat 502..545 CDD:276965 16/43 (37%)
Kelch 4 513..559 20/46 (43%)
KELCH repeat 549..593 CDD:276965 20/44 (45%)
Kelch 5 560..606 17/46 (37%)
KELCH repeat 596..638 CDD:276965 22/62 (35%)
Kelch 6 608..643 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312716at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.