DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and keap1a

DIOPT Version :8

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_878284.2 Gene:keap1a / 321837 ZFINID:ZDB-GENE-030131-556 Length:601 Species:Danio rerio

Alignment Length:573 Identity:242/574 (42%)
Similarity:344/574 (60%) Gaps:18/574 (3%)


  Fly    52 HSTLDDHDATDDDMTFCMSNYAKEALKMMYMMRSHGMLTDVVLEV--KKEL--FPAHKVVLSAAS 112
            |..||          :.:.::..:||:.|..:|.|.||.|:||.|  |.::  |..||:||:|:|
Zfish    26 HGYLD----------YTVESHPSKALQNMDELRHHEMLCDLVLHVTYKDKIVDFKVHKLVLAASS 80

  Fly   113 PYFKAMFTGGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVID 177
            ||||||||...||...|.|.|:.|||..:||::.|.||.:|.|.|..|..:|..|..:|:..|..
Zfish    81 PYFKAMFTSNFKECHASEVTLRDVCPQVISRLIDFAYTSRITVGETCVLHVLLTAMRYQMEEVAK 145

  Fly   178 ACCAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRR 242
            |||.||.:.|:|:|.|||:.|||:.||.:|..:...:|..:|.:|.:||||..||..||:.||.:
Zfish   146 ACCDFLMKNLEPSNVIGISRFAEEIGCTDLHLRTREYINTHFNEVTKEEEFFSLSHCQLLELISQ 210

  Fly   243 DELNVQEEREVYNAVLKWVKYDEDNRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLRKVPACRE 307
            |.|.|..|.|||.|.:.||::|.::|......:|.||....|.|.|||.|:::|.:|.|..:|::
Zfish   211 DSLKVLCESEVYKACIDWVRWDAESRAQYFHALLNAVHIYALPPTFLKRQLQSCPILSKANSCKD 275

  Fly   308 YLAKIFKDLTLHK-CPGVKERTPNTTRMIFVAGGFFRHSLDILEAYNVDDMTWTTLANLRIPRSG 371
            :|:|||.::.|.| .|....|   .|::|::|||:.:||||.|||::.....|..|.::..|.||
Zfish   276 FLSKIFHEMALRKPLPPTPHR---GTQLIYIAGGYKQHSLDTLEAFDPHKNVWLKLGSMMSPCSG 337

  Fly   372 LGAAFLKGKFYAVGGRNNNIGSSYDSDWVDRYSAVTETWRPCAPMSVPRHRVGVAVMDELMYAVG 436
            |||..|.|..|.|||||.::.::.:|..:..|:.:|..|...||::.||:||||.|:|..:||||
Zfish   338 LGACVLFGLLYTVGGRNLSLQNNTESGSLSCYNPMTNQWTQLAPLNTPRNRVGVGVIDGSIYAVG 402

  Fly   437 GSAGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFDGNERLASVECYHPEN 501
            ||....:||:||.|||:.:|||.|.||...|||.||......||.:|||||:.|..:||.|.|:.
Zfish   403 GSHASTHHNSVERYDPETNRWTFVAPMSVARLGAGVAACGGCLYVVGGFDGDNRWNTVERYQPDT 467

  Fly   502 NEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLATVERYDTENDTWDMVAPIQIARSALSL 566
            |.|..:.|:.|.|||.||..::.|:|.|||:||..||.|:|||:...|.|:.:|.:...|||..:
Zfish   468 NTWQHVAPMNTVRSGLGVVCMDNYLYAVGGYDGQTQLKTMERYNITRDVWEPMASMNHCRSAHGV 532

  Fly   567 TPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTTGTPLKSGRSGHASAVIYQP 619
            :....|::.:|||:...|||.||.|.|.:|.||..|.:..||||...||..:|
Zfish   533 SVYQCKIFVLGGFNQGGFLSSVECYCPASNVWTLVTDMPVGRSGMGVAVTMEP 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 BTB 80..183 CDD:279045 50/107 (47%)
PHA03098 92..599 CDD:222983 222/512 (43%)
BACK 192..294 CDD:285009 43/102 (42%)
Kelch 335..379 CDD:128874 20/44 (45%)
KELCH repeat 369..416 CDD:276965 19/47 (40%)
Kelch 382..430 CDD:128874 20/48 (42%)
KELCH repeat 420..463 CDD:276965 25/43 (58%)
Kelch 433..476 CDD:128874 24/43 (56%)
KELCH repeat 467..510 CDD:276965 20/43 (47%)
Kelch 478..523 CDD:128874 21/45 (47%)
KELCH repeat 514..558 CDD:276965 21/44 (48%)
Kelch_1 514..556 CDD:279660 21/42 (50%)
KELCH repeat 561..606 CDD:276965 18/45 (40%)
Kelch 572..616 CDD:128874 21/44 (48%)
keap1aNP_878284.2 BTB 44..151 CDD:279045 50/107 (47%)
PHA03098 54..571 CDD:222983 225/520 (43%)
BACK 160..262 CDD:285009 43/102 (42%)
Kelch 300..343 CDD:128874 19/43 (44%)
KELCH repeat 336..382 CDD:276965 19/46 (41%)
Kelch 346..396 CDD:128874 20/50 (40%)
KELCH repeat 386..429 CDD:276965 25/43 (58%)
Kelch 398..443 CDD:128874 24/45 (53%)
KELCH repeat 433..477 CDD:276965 20/44 (45%)
Kelch 444..490 CDD:128874 21/46 (46%)
KELCH repeat 480..525 CDD:276965 21/45 (47%)
Kelch 492..536 CDD:128874 18/44 (41%)
KELCH repeat 527..572 CDD:276965 18/45 (40%)
Kelch 538..584 CDD:128874 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BG44
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 549 1.000 Inparanoid score I1088
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312716at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596834
orthoMCL 1 0.900 OOG5_134673
Panther 1 1.100 O PTHR24412
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.