DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and Klhl18

DIOPT Version :8

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_001347235.1 Gene:Klhl18 / 270201 MGIID:2143315 Length:579 Species:Mus musculus

Alignment Length:604 Identity:196/605 (32%)
Similarity:298/605 (49%) Gaps:88/605 (15%)


  Fly    56 DDHDATDDDMTFCMSNYAKEALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFT 120
            |..:..:|.:.|.:|........:|..:|..|.|.||.|::....|.||::||:|:.|||.||||
Mouse     4 DGAEELEDLVHFSVSELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASIPYFHAMFT 68

  Fly   121 GGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLER 185
            ..:.|.:...:.:||:.|:|:..::.|.|.|.:.:.:..|..||..|:..|:.::.||||.||..
Mouse    69 NDMMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQNVQSLLMGASFLQLQSIKDACCTFLRE 133

  Fly   186 QLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNVQEE 250
            :|.|.|.:|:..|||...|..|...||.||.::|.:|...||||.|....::.|:.||||||:.|
Mouse   134 RLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSLSEEFLALPLEDVLELVSRDELNVKSE 198

  Fly   251 REVYNAVLKWVKYDEDNRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLRKVPACREYLAKIFKD 315
            .:|:.|.|.||:||.:.|...:..:|..:|.....|.||.::::..|::|....||: |....||
Mouse   199 EQVFEAALAWVRYDREQRGPCLPELLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRD-LVDEAKD 262

  Fly   316 LTLHKCPGVKERTPNTTRMIFVAGGFFRHSLDILEAYNVDDMTWTTLANLRIPRSGLGAAFLKGK 380
              .|..|   ||.|:                  |.|:.......|::|               |.
Mouse   263 --YHLMP---ERRPH------------------LPAFRTRPRCCTSIA---------------GL 289

  Fly   381 FYAVGGRNN--NIGSSYDSDWVDRYSAVTETWRPCAPMSVPRHRVGVAVMDELMYAVGGSAGMEY 443
            .|||||.|:  |..:....:.|:.:..:...|..|.||:..|.||||||::.|:||:||..|...
Mouse   290 IYAVGGLNSAANFYAGDSLNVVEVFDPIANRWEKCHPMTTARSRVGVAVVNGLLYAIGGYDGQLR 354

  Fly   444 HNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFDGNERLASVECYHPENNEWSFLP 508
            .:|||.|:|:.|.||.|..|::||..:|.||::..:|..||:|||..|.|||.|.||.::|:.:.
Mouse   355 LSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLNSVETYSPETDKWTVVT 419

  Fly   509 PLQTGRSGAGV-----------------------------------------------AAINQYI 526
            |:.:.||.|||                                               |::...:
Mouse   420 PMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAASMLNKRCRHGAASLGSKM 484

  Fly   527 YVVGGFDGTRQLATVERYDTENDTWDMVAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSIVEVY 591
            :|.||:||:..|:..|.|.:..|.|.::.|:...||.:||.....:|||:||:||.:.||.||:|
Mouse   485 FVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMY 549

  Fly   592 DPRTNTWTTGTPLKSGRSG 610
            ||.|:.||...|:.....|
Mouse   550 DPETDRWTFMAPMACHEGG 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 BTB 80..183 CDD:279045 38/103 (37%)
PHA03098 92..599 CDD:222983 184/556 (33%)
BACK 192..294 CDD:285009 38/102 (37%)
Kelch 335..379 CDD:128874 4/44 (9%)
KELCH repeat 369..416 CDD:276965 12/49 (24%)
Kelch 382..430 CDD:128874 19/50 (38%)
KELCH repeat 420..463 CDD:276965 22/43 (51%)
Kelch 433..476 CDD:128874 20/43 (47%)
KELCH repeat 467..510 CDD:276965 19/43 (44%)
Kelch 478..523 CDD:128874 21/92 (23%)
KELCH repeat 514..558 CDD:276965 17/91 (19%)
Kelch_1 514..556 CDD:279660 16/89 (18%)
KELCH repeat 561..606 CDD:276965 22/45 (49%)
Kelch 572..616 CDD:128874 19/40 (48%)
Klhl18NP_001347235.1 BTB_POZ_KLHL18 19..134 CDD:349556 39/115 (34%)
PHA03098 34..557 CDD:222983 187/562 (33%)
BACK_KLHL18 135..241 CDD:350532 41/106 (39%)
KELCH repeat 282..327 CDD:276965 14/60 (23%)
KELCH repeat 331..374 CDD:276965 22/43 (51%)
KELCH repeat 378..422 CDD:276965 19/44 (43%)
KELCH repeat 425..469 CDD:276965 5/44 (11%)
KELCH repeat 472..516 CDD:276965 12/44 (27%)
KELCH repeat 519..562 CDD:276965 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312716at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.