DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and Klhl17

DIOPT Version :8

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:XP_006239583.1 Gene:Klhl17 / 246757 RGDID:708444 Length:650 Species:Rattus norvegicus

Alignment Length:664 Identity:233/665 (35%)
Similarity:332/665 (50%) Gaps:62/665 (9%)


  Fly     1 MQTQMHSP---MQYETHISDMPNHKGYP-----------CRPEEAEMSNTSESCS--ISCGGRFG 49
            ||.:...|   .|...|.|..|..:..|           .||.:|..:...|...  :|..|...
  Rat     1 MQPRGERPAGRTQSPEHSSPGPGPEAPPPPQPPAPEAERARPRQARPAAPMEGAMQLLSREGHSV 65

  Fly    50 SAHSTLDDHDATDDDMTFCMSNYAKEALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPY 114
            :.:|....||                |...|..||..|:|.|:||.|..:...||||||::.|||
  Rat    66 AHNSKRHYHD----------------AFVAMSRMRQRGLLCDIVLHVAAKEIRAHKVVLASCSPY 114

  Fly   115 FKAMFTGGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDAC 179
            |.||||..:.||..:.|.|..:.|.|:.:::.|.||.:|.|.|..|..|||||::.|:..|.|||
  Rat   115 FHAMFTNEMSESRQTHVTLHDIDPQALDQLVQFAYTAEIVVGEGNVQTLLPAASLLQLNGVRDAC 179

  Fly   180 CAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDE 244
            |.||..||||:|.:||..||:.|.|.:|.|.|:.::.::|..|.:.|||:.|...|::.|:..|.
  Rat   180 CKFLLSQLDPSNCLGIRGFADTHSCSDLLKAAHRYVLQHFVDVAKTEEFMLLPLKQVLELVSSDS 244

  Fly   245 LNVQEEREVYNAVLKWVKYDEDNRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLRKVPACREYL 309
            |||..|.:||.|||.|||:|.|.|...:..::..||...|:.:||...:....::|..|.|::.|
  Rat   245 LNVPSEEDVYRAVLSWVKHDVDTRRQHVPRLMKCVRLPLLSRDFLLGHVDAESLVRHHPDCKDLL 309

  Fly   310 AKIFKDLTLHKCPGV-------KERTPNTTRMIFVAGG---FFRHSLDILEAYNVDDMTWTTLAN 364
            .:..|...|.:..||       ..|......::|..||   |..|.  ..|||:.....|..:|:
  Rat   310 IEALKFHLLPEQRGVLGTSRTRPRRCEGAGPVLFAVGGGSLFAIHG--DCEAYDTRTDRWHVVAS 372

  Fly   365 LRIPRSGLGAAFLKGKFYAVGGRNNNIGSSYDSDWVDRYSAVTETWRPCAPMSVPRHRVGVAVMD 429
            :...|:.:|.|.:..:.|||||.:   |:| |...|:.|..||.||:|...|...|..:|||.:.
  Rat   373 MSTRRARVGVAAVGNRLYAVGGYD---GTS-DLATVESYDPVTNTWQPEVSMGTRRSCLGVAALH 433

  Fly   430 ELMYAVGGSAGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRL----------LYAIGG 484
            .|:||.||..|....|:.|.|||....||.:..|..:|..|.|..:...          |||:||
  Rat   434 GLLYAAGGYDGASCLNSAERYDPLTGTWTSIAAMSTRRRYVRVATLGASWVYCLPTDGNLYAVGG 498

  Fly   485 FDGNERLASVECYHPENNEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLATVERYDTEND 549
            :|.:..||:||.|.|:.|.|:.:..:.:.||.||||.:...:||.||.|||..|.:||||.|:..
  Rat   499 YDSSSHLATVEKYEPQVNSWTPVASMLSRRSSAGVAVLEGALYVAGGNDGTSCLNSVERYSTKAG 563

  Fly   550 TWDMVAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTTGTPLKSGRSGHASA 614
            .|:.|||:.|.||...|..:|..|||:||.||::.|:.:|.|:||||.|...:.:.:.||....|
  Rat   564 AWESVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRTNKWVAASCMFTRRSSVGVA 628

  Fly   615 VI----YQPACSTT 624
            |:    :.|..|.|
  Rat   629 VLELLNFPPPSSPT 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 BTB 80..183 CDD:279045 48/103 (47%)
PHA03098 92..599 CDD:222983 202/527 (38%)
BACK 192..294 CDD:285009 38/102 (37%)
Kelch 335..379 CDD:128874 13/47 (28%)
KELCH repeat 369..416 CDD:276965 18/47 (38%)
Kelch 382..430 CDD:128874 20/48 (42%)
KELCH repeat 420..463 CDD:276965 17/43 (40%)
Kelch 433..476 CDD:128874 16/43 (37%)
KELCH repeat 467..510 CDD:276965 17/53 (32%)
Kelch 478..523 CDD:128874 20/55 (36%)
KELCH repeat 514..558 CDD:276965 23/44 (52%)
Kelch_1 514..556 CDD:279660 22/42 (52%)
KELCH repeat 561..606 CDD:276965 19/45 (42%)
Kelch 572..616 CDD:128874 19/44 (43%)
Klhl17XP_006239583.1 BTB 90..566 CDD:333434 180/482 (37%)
KELCH repeat 377..420 CDD:276965 18/47 (38%)
KELCH repeat 424..468 CDD:276965 18/44 (41%)
KELCH repeat 471..526 CDD:276965 17/55 (31%)
KELCH repeat 528..572 CDD:276965 23/44 (52%)
KELCH repeat 575..620 CDD:276965 19/45 (42%)
Kelch 587..631 CDD:128874 19/44 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312716at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.