DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4009 and Duox1

DIOPT Version :8

Sequence 1:NP_001262655.1 Gene:CG4009 / 42054 FlyBaseID:FBgn0038469 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001092767.1 Gene:Duox1 / 99439 MGIID:2139422 Length:1551 Species:Mus musculus

Alignment Length:565 Identity:161/566 (28%)
Similarity:247/566 (44%) Gaps:86/566 (15%)


  Fly    99 DGSCNNLLYPEFGIAVSRYRRLLP---------PRQVEQAPNARLISLSLY----GEQT-RNDRF 149
            ||..|||:...:|...||.:||:|         |.:....||.|.:|..:.    |:.: ||   
Mouse    33 DGWYNNLMEHRWGSKGSRLQRLVPASYADGVYQPLKEPYLPNPRHLSNRVMRGSAGQPSLRN--- 94

  Fly   150 RTMAAMQWGQFVAHDISQLSTQGAPQDCCAEPRHPRCLPINLPRGGPI--AYHTGKTCLHFARSV 212
            ||:..:.:|..|..|:..:.|.|.|.:         .|.|.:|.|.|:  ....|...|.|.||.
Mouse    95 RTVLGVFFGYHVLSDLVSVETPGCPAE---------FLNIYIPHGDPVFDPDKRGNVVLPFQRSR 150

  Fly   213 SDADAICPKVEEPQPEKLTVATAYLDLSSIYGNNPSQNRKVRLFKGGLLKT---------SYTNG 268
            .|.:. ......|:.:...| |.:||.|:|||::.|.:..:|.|.||.|.:         |.::.
Mouse   151 WDRNT-GQSPSNPRDQSNQV-TGWLDGSAIYGSSHSWSDTLRSFSGGQLASGPDPAFPSDSQSSL 213

  Fly   269 QHWLPVSQNENGECGAKSECYIVPDIRNRFSPTIALLQTLLVREHNRLAENLALINPDHSDERIF 333
            ..|: ......|:.|.:. .|.....|....|.:..|..|..|.||..|..||..:|...||.:|
Mouse   214 LMWM-APDPSTGQGGPRG-VYAFGAQRGNREPFLQALGLLWFRYHNLCARKLAQEHPHWGDEELF 276

  Fly   334 QEARKINIAQFQKITYYDWLPLFVGRTYTYLNGLIYPVEPTEYVNDYDETVNPAAYAEFSAAAFR 398
            |.|||..||.:|.|..|:|||.|:.:|            |.||.. |...::|:...||..|:.:
Mouse   277 QHARKRVIATYQNIAMYEWLPSFLKQT------------PPEYPG-YRPFLDPSISPEFVVASEQ 328

  Fly   399 YAHTQIPG----------WFSLVAPNRRSNRTMRLSDFLDRTETIRLLDTSDNFDALLRGLATQL 453
            :..|.:|.          :..:.:.|...:..:|:.:.....|..: |..:::.||||.|:|:|:
Mouse   329 FLSTMVPSGVYMRNASCHFQGIPSHNSSVSGALRVCNSYWSREHPK-LQRAEDVDALLLGMASQI 392

  Fly   454 HKRSDGNIDREIKHY------FNRKEFEEYGSDLKSIDIQRARDFGLASYNDVREFCGLRRAVDW 512
            .:|.|..:..:::.:      |:|.::      |.|. :||.||.||.||...||..||.....|
Mouse   393 AEREDHVVVEDMQDFWPGPLKFSRTDY------LASC-LQRGRDLGLPSYTKAREALGLSPISHW 450

  Fly   513 ADFAHEIPGEKISLLRRLYATPDD----VELGVGGTLEYHVPDALFGPTLLCVIGKQFLNTRRGD 573
            .|....:.....::|....|..:.    :||..||.||.|...   ||....::..||:..|.||
Mouse   451 QDINPALSRSNGTVLEATAALYNQDLSRLELLPGGLLESHGDP---GPLFSTIVLDQFVRLRDGD 512

  Fly   574 RFFFERENEGGFSRAQLAEIRKVSLSSLFCSNANY-LHLIQPNVF 617
            |::||....|.||:.::||||..||..:..:..|. ...:|||||
Mouse   513 RYWFENTRNGLFSKEEIAEIRNTSLRDILVAVTNVDPSALQPNVF 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4009NP_001262655.1 An_peroxidase_like 77..>367 CDD:265428 86/293 (29%)
An_peroxidase 95..610 CDD:281139 156/557 (28%)
peroxinectin_like 228..605 CDD:188655 116/406 (29%)
Duox1NP_001092767.1 An_peroxidase 30..546 CDD:281139 155/553 (28%)
dual_peroxidase_like 32..591 CDD:188652 161/566 (28%)
CM_2 711..778 CDD:280063
EFh 820..881 CDD:238008
EF-hand_7 820..880 CDD:290234
EF-hand_7 857..921 CDD:290234
EFh 857..915 CDD:238008
Ferric_reduct 1091..1235 CDD:280043
NOX_Duox_like_FAD_NADP 1277..1551 CDD:99783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.