DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4009 and frp2

DIOPT Version :8

Sequence 1:NP_001262655.1 Gene:CG4009 / 42054 FlyBaseID:FBgn0038469 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_595271.1 Gene:frp2 / 2541227 PomBaseID:SPBC947.05c Length:564 Species:Schizosaccharomyces pombe

Alignment Length:353 Identity:65/354 (18%)
Similarity:106/354 (30%) Gaps:120/354 (34%)


  Fly   129 APNARLISLSLYGEQTRNDRFRTMAAMQWG-QFVAHDISQLSTQGAPQDCC---------AEPRH 183
            :|...|:::...|::|:|    ::|:..|. ..||..:..||        |         :...:
pombe    81 SPLVMLVTIPFTGKETKN----SIASYDWNLTGVAARLGYLS--------CGLFFVSYFFSLKNN 133

  Fly   184 PRCLPINLPRGGPIAYHTGKTCLH-----FARSVSDADAICPKVEEPQPEKLTVATAYLDLSSIY 243
            |.||.:       .:.|.....||     :|..:|....|...:...|..|    ....|..|||
pombe   134 PFCLML-------FSSHEKMNYLHRWLSVYAVLISVLHGILFMIFSAQSYK----PLLYDKISIY 187

  Fly   244 G-------------NNPSQNRK---------------------------VRLFKGGLLKTSYTNG 268
            |             :.||..||                           :...|..::..::..|
pombe   188 GYFITVVLFLMTVASLPSVRRKFFEWFFVLHHTCSVLIIFLIWLHHPRTIVYMKACIIIYAFDRG 252

  Fly   269 QHWLPVSQNENGECGAKSECYIVPDIRNRFSPTIALLQTLLVREHNRLAENLALINPDHSDERIF 333
                               |.:...|.||.:..|.||...::....|..:......|..:...::
pombe   253 -------------------CRLFRSIWNRSNFRIYLLNEDMIYMVGRKPKRSFFALPWAAGSHVY 298

  Fly   334 QEARKINIAQFQKIT-----YYDWLPLFV-----------GRTYT----YLNGLIYPVEPTEYVN 378
            .....::..|....|     :.|::.|||           .|.|:    |.|..:.|..|....|
pombe   299 INIPSLSYWQVHPFTLASAPFDDFIELFVAVHSGFTERLANRLYSMPHEYPNFSLAPGTPESLSN 363

  Fly   379 DYDETVNPAAYA-EFSAAAFRYAHTQIP 405
            .|.|..:..:|| |....|  ..||..|
pombe   364 TYRELNSFKSYAVEIENTA--QGHTYEP 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4009NP_001262655.1 An_peroxidase_like 77..>367 CDD:265428 53/313 (17%)
An_peroxidase 95..610 CDD:281139 65/354 (18%)
peroxinectin_like 228..605 CDD:188655 43/240 (18%)
frp2NP_595271.1 Ferric_reduct 117..228 CDD:280043 23/130 (18%)
NOX_Duox_like_FAD_NADP 271..488 CDD:99783 24/122 (20%)
NAD_binding_6 414..547 CDD:285298
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.