DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5225 and dpy-7

DIOPT Version :8

Sequence 1:NP_650587.1 Gene:CG5225 / 42053 FlyBaseID:FBgn0038468 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_509274.1 Gene:dpy-7 / 181013 WormBaseID:WBGene00001069 Length:318 Species:Caenorhabditis elegans

Alignment Length:307 Identity:93/308 (30%)
Similarity:104/308 (34%) Gaps:126/308 (41%)


  Fly    67 QHC------NCPPGPPGPP---GPPGL------PGTPG-------------------PQGPKGHT 97
            |.|      .|||||.|||   |.||:      ||.||                   |.||.|..
 Worm    88 QQCTSCVQLRCPPGPIGPPGVSGEPGMDGANGRPGKPGLDGLDVPLDPEPAFPCVICPAGPPGTR 152

  Fly    98 GSKGE---RGEKGERGHYGLPGQPGEPGPIGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPP 159
            |.:||   .|:.||.||.||||:||:||.:|..|..|.||.:...|                   
 Worm   153 GPQGEVGRPGQTGESGHPGLPGRPGKPGRVGDAGPQGEPGEQGEPG------------------- 198

  Fly   160 PPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKGPPGPPGPPGTG 224
                                             |..||.....|    ..|.|||||||||  .|
 Worm   199 ---------------------------------IKGPPGDDSIG----GTGIKGPPGPPGP--RG 224

  Fly   225 PPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVPWPSKGHKGDKG 289
            |.||||..|.......||.|.....||.   ||.|...||| |||:            |..||.|
 Worm   225 PKGPPGSNGLPSQNSGPPGPIGEMGPPG---PPGPRGEPGP-PGPF------------GPPGDSG 273

  Fly   290 HKGGHKGDKGGHHHHYYPPGHD-----------KGGYYPYPPHGGHG 325
            ..|||.....|......|...:           :|||    ..||:|
 Worm   274 EPGGHCPSSCGVQEIVAPSVSELDTNDEPEKPARGGY----SGGGYG 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5225NP_650587.1 None
dpy-7NP_509274.1 Col_cuticle_N 11..62 CDD:198156
Collagen 145..203 CDD:189968 28/110 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24023
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.