DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5225 and col5a1

DIOPT Version :8

Sequence 1:NP_650587.1 Gene:CG5225 / 42053 FlyBaseID:FBgn0038468 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_004916702.1 Gene:col5a1 / 100038277 XenbaseID:XB-GENE-5954567 Length:1865 Species:Xenopus tropicalis

Alignment Length:701 Identity:195/702 (28%)
Similarity:230/702 (33%) Gaps:232/702 (33%)


  Fly    15 GLANSKNPSAETGRLIASLQAAPAPAPAQSVIYKLP-----------------PQHYYPP----- 57
            |:...:.|:.|||.:.......|...|.:.   .||                 |....||     
 Frog  1023 GVVGPQGPTGETGPMGERGHPGPPGPPGEQ---GLPGVAGKEGSKGDPGPAGLPGKDGPPGLRGF 1084

  Fly    58 ------PPPPPPPPPQHCNCPPGPPGPPGPP------------GLPGTPGPQGPKGHTGSKGERG 104
                  |.|...|..:....|||||||.|.|            ||||.||||||.|..|.||..|
 Frog  1085 TGERGLPGPIGVPGLKGNEGPPGPPGPAGSPGERGAAGPAGPIGLPGRPGPQGPPGPAGEKGTPG 1149

  Fly   105 EK------------------------------GERGHYGLPGQ------------PGEPGPIGPP 127
            ||                              |::|..|.|||            ||.|||.||.
 Frog  1150 EKGPQGPAGRDGIQGPVGLPGPAGPVGPPGEDGDKGEIGEPGQKGNRGDKGEQGPPGPPGPQGPI 1214

  Fly   128 GLPGPPGHKSGHGHHDHH--------DHHHHHPAPPPP------PPPP-------------PPPP 165
            |.|||.|.....|.....        :.......||.|      |.||             ||.|
 Frog  1215 GQPGPSGSDGEPGPRGQQGLFGQKGDEGPRGFAGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGP 1279

  Fly   166 PPPPPPHSHPHSHHPHPP---IVTPPII-------------VPIPL--PPQKGEHGHHHHH--KG 210
            |.|..|...|.:..|..|   |..|..:             :|..|  |..|||.|.....  :|
 Frog  1280 PGPRGPSGSPGADGPQGPPGGIGNPGPVGEKGDPGESGEPGLPGELGPPGPKGERGEKGEAGLQG 1344

  Fly   211 SKGPPGPPGPPG-TGPPGPPGPPGTTYPQPPPPPPPPPP-----PP-----------PSYPYP-- 256
            :.|||||.|||| .||.|.|||.|  :|..|.||....|     ||           |..|.|  
 Frog  1345 TSGPPGPKGPPGDDGPKGSPGPVG--FPGDPGPPGESGPAGQDGPPGDKGEDGESGQPGSPGPTG 1407

  Fly   257 -PYPYPPPGPYPGPWIPLPVPVPWPSKGHKGDKGHKG--GHKGDKG--GHHHHYYPPGHDKGGYY 316
             |.|..|||. .||      |.|...:|.:|:||.||  |.:|..|  |......|||.      
 Frog  1408 EPGPSGPPGK-RGP------PGPTGPEGRQGEKGAKGESGLEGPPGKTGPIGPQGPPGK------ 1459

  Fly   317 PYP--------PHGGHGGHHHPG-HNYPGPYPPPYPPHHPHDGGDKGYHHY--------PPHNHG 364
            |.|        |.|..|....|| ...|||..||..|....|.|.||...:        ||...|
 Frog  1460 PGPEGLRGIPGPVGEQGLPGSPGPDGPPGPMGPPGIPGLKGDSGPKGEKGHPGLIGLIGPPGEQG 1524

  Fly   365 GHNHGGHNNHHPPH--NGEHNHNHPPHNHGGHGHHHPSHNHGGQDPHNTHPHTGTHGNGGHSQTS 427
            .....|......||  .||.....|   .|..|...|....||..|......:|..|..|.|.. 
 Frog  1525 EKGDRGLPGPQGPHGAKGEQGILGP---SGPVGPPGPPGLPGGPGPKGAKGSSGPTGPKGESGI- 1585

  Fly   428 HHQHPHHHQPKPTKPEG------------SGEQTPRDDLDLLDENVEIVENIIDEN-DNENNFME 479
                     |.|..|.|            |.::|.|        :::..:.:.|.| ||..::.:
 Frog  1586 ---------PGPPGPPGPPGEVIQPLPIHSSKRTRR--------SIDASQVVDDGNADNYMDYAD 1633

  Fly   480 GEEEMSNEPNDLETEPEDADYGLEYADNTVE--------NPESPSGAEEID 522
            |.||:....|.|:.|.|...:.|....|...        :||.|.|...||
 Frog  1634 GMEEIFGSLNSLKQEIEQMKHPLGNQQNPARTCKDLLLCHPELPDGEYWID 1684

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5225NP_650587.1 None
col5a1XP_004916702.1 TSPN 37..227 CDD:214560
Collagen 588..647 CDD:189968
Collagen 752..808 CDD:189968
Collagen 804..863 CDD:189968
Collagen 858..915 CDD:189968
Collagen 897..956 CDD:189968
Collagen 1221..1269 CDD:189968 8/48 (17%)
Collagen 1500..1545 CDD:189968 12/45 (27%)
COLFI 1637..1863 CDD:279718 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.