DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17556 and CG3678

DIOPT Version :8

Sequence 1:NP_001262652.1 Gene:CG17556 / 42046 FlyBaseID:FBgn0038462 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001262651.1 Gene:CG3678 / 42045 FlyBaseID:FBgn0038461 Length:282 Species:Drosophila melanogaster

Alignment Length:282 Identity:281/282 - (99%)
Similarity:282/282 - (100%) Gaps:0/282 - (0%)


  Fly     1 MSLDYEKMSWSDVRDQFRTWREETGRHSEEVVQLWVAVLEDKVHKTGNERHLILEQVIIAALDTA 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MSLDYEKMSWSDVRDQFRTWREETGRHSEEVVQLWVAVLEDKVHKTGNERHLILEQVIIAALDTA 65

  Fly    66 RFDIATKCTKQLSLEFPGSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAAPRKRKIAILK 130
            ||||||||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 RFDIATKCTKQLALEFPGSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAAPRKRKIAILK 130

  Fly   131 ARGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGKAAFCMEEVLLHNPHSHLIHQRLAE 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 ARGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGKAAFCMEEVLLHNPHSHLIHQRLAE 195

  Fly   196 IRYTMGGVENMESARTYYSQALKLNPHNLRALYGIYLCCNHLDNSRAVSSKRKELQKLSQWALEQ 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 IRYTMGGVENMESARTYYSQALKLNPHNLRALYGIYLCCNHLDNSRAVSSKRKELQKLSQWALEQ 260

  Fly   261 LLTKQTIVPLEAAFGNLEIKSN 282
            ||||||||||||||||||||||
  Fly   261 LLTKQTIVPLEAAFGNLEIKSN 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17556NP_001262652.1 TPR repeat 86..113 CDD:276809 26/26 (100%)
TPR_11 154..221 CDD:290150 66/66 (100%)
TPR repeat 154..181 CDD:276809 26/26 (100%)
TPR repeat 186..219 CDD:276809 32/32 (100%)
CG3678NP_001262651.1 TPR repeat 86..113 CDD:276809 26/26 (100%)
TPR_11 154..221 CDD:290150 66/66 (100%)
TPR repeat 154..181 CDD:276809 26/26 (100%)
TPR repeat 186..219 CDD:276809 32/32 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C218447656
eggNOG 1 0.900 E1_KOG3060
Homologene 1 1.000 H8785
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D465703at33208
OrthoFinder 1 1.000 FOG0003386
orthoMCL 1 0.900 OOG5_128353
Panther 1 1.100 P PTHR12760
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.