DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AhcyL2 and SAH1

DIOPT Version :8

Sequence 1:NP_996221.1 Gene:AhcyL2 / 42043 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_010961.3 Gene:SAH1 / 856766 SGDID:S000000845 Length:449 Species:Saccharomyces cerevisiae

Alignment Length:447 Identity:223/448 (50%)
Similarity:300/448 (67%) Gaps:17/448 (4%)


  Fly    62 SAGGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIE 126
            ||...::.:..||.:||||:|||:||.||||:|.:||...|.:|||||.|.||.|:..|:|||||
Yeast     2 SAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIRKAYGDVQPLKGARIAGCLHMTIQTAVLIE 66

  Fly   127 TLVQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAIYS--DGWQPNLI 189
            |||.|||.|.|::|||||||:..|||:|.:|:|:|||:||||||:.||:::.:::  |..:.|||
Yeast    67 TLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLFAFKDNKKLNLI 131

  Fly   190 LDDGGDATHLMLKKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFY 254
            ||||||.|.|:.:|:|:..:...|:.||:.||||.||.:.|.|||.||||||||||||:|||..|
Yeast   132 LDDGGDLTTLVHEKHPEMLEDCFGLSEETTTGVHHLYRMVKEGKLKVPAINVNDSVTKSKFDNLY 196

  Fly   255 TCRDSILDSLKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFR 319
            .||:|::|.:||.||:|..||..|:.||||||||||.:|:|.|..|.|||:|||.||||||:|::
Yeast   197 GCRESLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGARVLVTEIDPINALQAAMEGYQ 261

  Fly   320 VVRLNEVIRTVDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRS 384
            ||.:.:......|.||.||.:::|..:|...|....|:||:||...||||..|.........::.
Yeast   262 VVTMEDASHIGQVFVTTTGCRDIINGEHFINMPEDAIVCNIGHFDIEIDVAWLKANAKECINIKP 326

  Fly   385 QVDHIRWPDGRMIILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFSA------------- 435
            |||......||.:||||.||||||.|:| .||||:|.:.|.|.||.|.||.:             
Yeast   327 QVDRYLLSSGRHVILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSNDKSFREKHIEFQ 391

  Fly   436 -PGRYKSDVYLLPKKMDEYVASLHLATFDAHLTELTDEQSKFMGLNKAGPFKANYYR 491
             .|.::..|::|||.:||.||..||......||:|:..||:::|:.:.|||||::||
Yeast   392 KTGPFEVGVHVLPKILDEAVAKFHLGNLGVRLTKLSKVQSEYLGIPEEGPFKADHYR 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 218/440 (50%)
AdoHcyase 67..491 CDD:283003 220/441 (50%)
SAH1NP_010961.3 AdoHcyase 7..448 CDD:310083 220/441 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45620670
eggNOG 1 0.900 E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S93
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23420
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.