DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AhcyL2 and ahcyl1

DIOPT Version :8

Sequence 1:NP_996221.1 Gene:AhcyL2 / 42043 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_958450.1 Gene:ahcyl1 / 798918 ZFINID:ZDB-GENE-021206-7 Length:512 Species:Danio rerio

Alignment Length:467 Identity:332/468 (71%)
Similarity:394/468 (84%) Gaps:3/468 (1%)


  Fly    27 ARRFSDVSTCSFSSTC-FTGSSDEEDVSPKDNHQRNSAGGTDFCVKSISKSAFGRREIEIAESEM 90
            :|..|..||.|:||.. :|.|||:| .||::..|.||.|.:|||||:|.::.||||||||||.:|
Zfish    46 SRSISQSSTDSYSSAASYTDSSDDE-TSPREKSQVNSKGSSDFCVKNIKQAEFGRREIEIAEQDM 109

  Fly    91 PGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGATVRWAACNIYSTQNAVAAALAE 155
            ..:::|||||:.||||.||.:.||||:.||:||||||||.|||..||.|||||||||.|||||||
Zfish   110 SALISLRKRAQGEKPLAGAKVAGCTHITAQTAVLIETLVALGAQCRWTACNIYSTQNEVAAALAE 174

  Fly   156 AGIPIFAWRGETEEEFWWCLDRAIYSDGWQPNLILDDGGDATHLMLKKYPDYFKAIRGIVEESVT 220
            :|:.:|||:||:|::||||:||.:..||||.|:|||||||.||.:.||||..||.:|||||||||
Zfish   175 SGVSVFAWKGESEDDFWWCIDRCVNMDGWQANMILDDGGDLTHWVYKKYPSVFKKVRGIVEESVT 239

  Fly   221 GVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDSLKRTTDIMFGGKQVVICGYGDV 285
            ||||||.|||.|||.|||:||||||||.|||..|.||:||||.||||||:||||||||:||||:|
Zfish   240 GVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEV 304

  Fly   286 GKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIRTVDVVVTATGNKNVITRDHMNR 350
            ||||..:||..|.||.|||:||||||||.|||||||:||||:|.:|:|:|.||||||:||:|::|
Zfish   305 GKGCCSALKALGAIVCVTEIDPICALQACMDGFRVVKLNEVVRQMDMVITCTGNKNVVTREHLDR 369

  Fly   351 MKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPDGRMIILLAEGRLVNLSCSTISS 415
            ||||||:||||||.:||||..|.|||||||||||||||:.||||:.:||||||||:||||||:.|
Zfish   370 MKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRVILLAEGRLLNLSCSTVPS 434

  Fly   416 FVVSVASSTQALALIELFSAP-GRYKSDVYLLPKKMDEYVASLHLATFDAHLTELTDEQSKFMGL 479
            ||:|:.::|||||||||::|| ||||.||||||||||||||||||..||||||||:|||:|:|||
Zfish   435 FVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPNFDAHLTELSDEQAKYMGL 499

  Fly   480 NKAGPFKANYYR 491
            ||.||||.||||
Zfish   500 NKNGPFKPNYYR 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 310/424 (73%)
AdoHcyase 67..491 CDD:283003 313/425 (74%)
ahcyl1NP_958450.1 AdoHcyase 86..511 CDD:283003 313/425 (74%)
PRK05476 86..506 CDD:235488 309/420 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45609728
eggNOG 1 0.900 E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D207688at33208
OrthoFinder 1 1.000 FOG0002342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130931
Panther 1 1.100 O PTHR23420
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.