DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AhcyL2 and ahcy

Sequence 1:NP_996221.1 Gene:AhcyL2 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001037894.1 Gene:ahcy XenbaseID:XB-GENE-950017 Length:433 Species:Xenopus tropicalis

Alignment Length:424 Identity:219/425 (52%)
Similarity:297/425 (70%) Gaps:2/425 (0%)


  Fly    70 VKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGAT 134
            |..||.:.:||:.|||||:||||:|.:|:...:.||||||.|.||.|:..|:|||||||..|||.
 Frog     9 VADISLAEWGRKAIEIAENEMPGLMKMREMYSESKPLKGARIAGCLHMTLQTAVLIETLTALGAE 73

  Fly   135 VRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAIY-SDGWQPNLILDDGGDATH 198
            |:|::|||:|||:..|||:|:.|:|::||:|||:||:.||:|:.:| .||...|:|||||||.|:
 Frog    74 VQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYIWCIDQTLYFKDGKPLNMILDDGGDLTN 138

  Fly   199 LMLKKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDS 263
            |:..|||...|.|:||.||:.||||.||.:...|.|.||||||||||||:|||..|.||:|::|.
 Frog   139 LVHTKYPQLLKGIKGISEETTTGVHNLYKMKASGTLQVPAINVNDSVTKSKFDNLYGCRESLIDG 203

  Fly   264 LKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIR 328
            :||.||:|..||..|:.|||||||||||:|:..|..|.:||:|||.||||||:|:.|..:.|..:
 Frog   204 IKRATDVMIAGKVAVVAGYGDVGKGCAQALRAFGARVIITEIDPINALQAAMEGYEVTTMEEASK 268

  Fly   329 TVDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPD 393
            ..::.||.||..:::...|...||:..|:||:||...|:||..|:...:....::.|||.....:
 Frog   269 EGNIFVTTTGCTDIVEGSHFENMKDDSIVCNIGHFDCELDVKWLNDNAVKKVNIKPQVDRYLLKN 333

  Fly   394 GRMIILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFSAPGRYKSDVYLLPKKMDEYVASL 457
            ||.||||||||||||.|:. ..|||:|.:.:.|.:|.|||::...:|...||.||||:||.||:.
 Frog   334 GRHIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTNNDKYPVGVYFLPKKLDEAVAAA 398

  Fly   458 HLATFDAHLTELTDEQSKFMGLNKAGPFKANYYR 491
            ||......||:|||:|:|::||.|.||||.::||
 Frog   399 HLDKLGVKLTKLTDKQAKYLGLEKEGPFKPDHYR 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 216/418 (52%)
AdoHcyase 67..491 CDD:283003 218/423 (52%)
ahcyNP_001037894.1 PRK05476 1..427 CDD:235488 216/418 (52%)
AdoHcyase 7..432 CDD:283003 218/423 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.