DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AhcyL2 and AhcyL1

Sequence 1:NP_996221.1 Gene:AhcyL2 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_647746.1 Gene:AhcyL1 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster

Alignment Length:478 Identity:368/479 (77%)
Similarity:430/479 (90%) Gaps:4/479 (1%)


  Fly    18 TAVKKSS-IEARRFSDVSTCSFSSTCFTGSS-DEEDVSPKDNHQRNSAGGTDFCVKSI-SKSAFG 79
            :|:||:| ..:|..|..||.||||..:|||| |.:||.|::..|:||.|.:||||::| ::.|||
  Fly    43 SALKKTSRYRSRSLSASSTDSFSSASYTGSSEDGDDVPPREKVQKNSKGSSDFCVRNIGAQHAFG 107

  Fly    80 RREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGATVRWAACNIYS 144
            ||||||||.|||||:.|:|||.::||||.|.||||||:|||:||||||||:|||:||||||||||
  Fly   108 RREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELGASVRWAACNIYS 172

  Fly   145 TQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAIYSDGWQPNLILDDGGDATHLMLKKYPDYFK 209
            |||.|||||||:|||||||||||||:||||:||.:.::.||||:|||||||||||||||||..||
  Fly   173 TQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENWQPNMILDDGGDATHLMLKKYPTMFK 237

  Fly   210 AIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDSLKRTTDIMFGG 274
            .::||||||||||||||.|||.|||||||:||||||||.|||..|:|::||||||||:||:||||
  Fly   238 LVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDSLKRSTDVMFGG 302

  Fly   275 KQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIRTVDVVVTATGN 339
            ||||:||||||||||||:|||||||||:||:||||||||:|||||||:||||||.||:|||||||
  Fly   303 KQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVIRNVDIVVTATGN 367

  Fly   340 KNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPDGRMIILLAEGR 404
            |||:.|:||::||:|||:||||||.:|||||||.||:||||:||||||||.||:|:.||||||||
  Fly   368 KNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKVRSQVDHIIWPEGKYIILLAEGR 432

  Fly   405 LVNLSCSTISSFVVSVASSTQALALIELFSA-PGRYKSDVYLLPKKMDEYVASLHLATFDAHLTE 468
            |||||||:|.||.||:.|:||||||||||:| ||||||||||||||||||||||||.||||||||
  Fly   433 LVNLSCSSIPSFAVSITSATQALALIELFNAPPGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTE 497

  Fly   469 LTDEQSKFMGLNKAGPFKANYYR 491
            |:|||:|:||||||||||.||||
  Fly   498 LSDEQAKYMGLNKAGPFKPNYYR 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 340/425 (80%)
AdoHcyase 67..491 CDD:283003 343/426 (81%)
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:283003 343/426 (81%)
PRK05476 94..515 CDD:235488 339/421 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45250231
eggNOG 1 0.900 E1_COG0499
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 738 1.000 Inparanoid score I554
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D207688at33208
OrthoFinder 1 1.000 FOG0002342
orthoMCL 1 0.900 OOG5_130931
Panther 1 1.100 P PTHR23420
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.