DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AhcyL2 and Ahcyl2

Sequence 1:NP_996221.1 Gene:AhcyL2 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001166981.2 Gene:Ahcyl2 RGDID:1564895 Length:612 Species:Rattus norvegicus

Alignment Length:494 Identity:342/495 (69%)
Similarity:408/495 (82%) Gaps:12/495 (2%)


  Fly     8 TFADLSLADK--------TAVKKSSIEARRFSDVSTCSFSSTC-FTGSSDEEDVSPKDNHQRNSA 63
            |...:..||:        |.:.:.|: :|..|..||.|:||.. :|.|||:| .||:|..|:||.
  Rat   120 TVKKIQFADQKQEFNKRPTKIGRRSL-SRSISQSSTDSYSSAASYTDSSDDE-TSPRDKQQKNSK 182

  Fly    64 GGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETL 128
            |.:|||||:|.::.||||||||||.|||.:|.|||||:.||||.||.||||||:.||:|||:|||
  Rat   183 GSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETL 247

  Fly   129 VQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAIYSDGWQPNLILDDG 193
            ..|||..||||||||||.|.|||||||:|.|:|||:||:|::||||:||.:..:|||||:|||||
  Rat   248 GALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQPNMILDDG 312

  Fly   194 GDATHLMLKKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRD 258
            ||.||.:.||||:.||.|:||||||||||||||.|||.|||.|||:||||||||.|||..|.||:
  Rat   313 GDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRE 377

  Fly   259 SILDSLKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRL 323
            ||||.||||||:||||||||:||||:|||||..:||..|.:|||||:||||||||.|||||:|:|
  Rat   378 SILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSVVYVTEIDPICALQACMDGFRLVKL 442

  Fly   324 NEVIRTVDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDH 388
            |||||.||:|:|.||||||:||:|::||||.||:||||||.:||||..|.|||||||||||||||
  Rat   443 NEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDH 507

  Fly   389 IRWPDGRMIILLAEGRLVNLSCSTISSFVVSVASSTQALALIELFSAP-GRYKSDVYLLPKKMDE 452
            :.||||:.|:|||||||:||||||:.:||:|:.::|||||||||::|| ||||.|||||||||||
  Rat   508 VIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDE 572

  Fly   453 YVASLHLATFDAHLTELTDEQSKFMGLNKAGPFKANYYR 491
            |||||||.|||||||||||||:|::||||.||||.||||
  Rat   573 YVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYR 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 314/424 (74%)
AdoHcyase 67..491 CDD:283003 317/425 (75%)
Ahcyl2NP_001166981.2 AdoHcyase 186..611 CDD:283003 317/425 (75%)
PRK05476 186..606 CDD:235488 313/420 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45609134
eggNOG 1 0.900 E1_COG0499
Hieranoid 1 1.000
Homologene 1 1.000 H69337
Inparanoid 1 1.050 738 1.000 Inparanoid score I554
OMA 1 1.010
OrthoDB 1 1.010 D207688at33208
OrthoFinder 1 1.000 FOG0002342
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130931
Panther 1 1.100 O PTHR23420
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.