DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AhcyL2 and ahcyl1

Sequence 1:NP_996221.1 Gene:AhcyL2 FlyBaseID:FBgn0015011 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001121447.1 Gene:ahcyl1 XenbaseID:XB-GENE-942022 Length:278 Species:Xenopus tropicalis

Alignment Length:235 Identity:137/236 (58%)
Similarity:167/236 (71%) Gaps:15/236 (6%)


  Fly     1 MAKMP-ETTFAD-----LSLADKTAVKKSSIEARRFSDVSTCSFSSTCFTGSSDEEDVSPKDNHQ 59
            ::|.| :..|||     .....||..:..|   |..|..||.|:||    .|||:| .||:|..|
 Frog    24 VSKTPKKIQFADDMQEFSKFPTKTGRRSLS---RSISQSSTDSYSS----DSSDDE-TSPRDKQQ 80

  Fly    60 RNSAGGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVL 124
            ..|.|..|||||:|.::.||||||||||.||..:::|||||:.||||.||.||||||:.||:.||
 Frog    81 ITSKGSADFCVKNIKQADFGRREIEIAEQEMMALISLRKRAQGEKPLLGAKIVGCTHITAQTGVL 145

  Fly   125 IETLVQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAIYSD-GWQPNL 188
            ||||..|||..||:|||||||||.|||||||:|:.||||:||:|::||||:||.:.:| |||.|:
 Frog   146 IETLCALGAQCRWSACNIYSTQNEVAAALAESGVAIFAWKGESEDDFWWCIDRCVNADSGWQANM 210

  Fly   189 ILDDGGDATHLMLKKYPDYFKAIRGIVEESVTGVHRLYML 228
            |||||||.||.:.||||..:|.||||||||||||||.:.|
 Frog   211 ILDDGGDLTHWVYKKYPHVYKQIRGIVEESVTGVHREFGL 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AhcyL2NP_996221.1 PRK05476 63..486 CDD:235488 113/168 (67%)
AdoHcyase 67..491 CDD:283003 112/164 (68%)
ahcyl1NP_001121447.1 NADB_Rossmann 88..>246 CDD:304358 110/158 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45610537
eggNOG 1 0.900 E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.720

Return to query results.
Submit another query.