DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HB20

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:164 Identity:42/164 - (25%)
Similarity:72/164 - (43%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 QTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMK-----LKKELRAVKEINEQAR 468
            |...|||.|...:.|...|:|::|.||.:..|||.|||||||.:     |:::..::|:..|..:
plant    95 QVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWK
TRQLERDYDSLKKQFESLK 159

  Fly   469 RDREE----QEKMKAQETMKSAQQNKQ------VQQQQQQQQQQQQQQQQQHQQQQQQPQD---- 519
            .|...    .:|:.| |.|  |.:||:      |:::.:.........:.......:.|::    
plant   160 SDNASLLAYNKKLLA-EVM--ALKNKECNEGNIVKREAEASWSNNGSTENSSDINLEMPRETITT 221

  Fly   520 HHSII-----------AHNPG-HLHHSVVGQNDL 541
            |.:.|           ||:.. |.:|.:|.:..|
plant   222 HVNTIKDLFPSSIRSSAHDDDHHQNHEIVQEESL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/49 (43%)
Abdominal-A 456..478 CDD:289192 4/25 (16%)
HB20NP_186771.1 HOX 87..140 CDD:197696 21/44 (48%)
HALZ 142..183 CDD:280364 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.