DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Cdx2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_076453.1 Gene:Cdx2 / 66019 RGDID:621234 Length:310 Species:Rattus norvegicus


Alignment Length:413 Identity:101/413 - (24%)
Similarity:137/413 - (33%) Gaps:161/413 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 HHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGDSSCSPSPS--ASGSSSLHRSLNDNSPGSAS 228
            :|::..||||...                     ||:.||.||  .:..:.|....|..:||   
  Rat    43 YHVAAAAAAAANL---------------------DSAQSPGPSWPTAYGAPLREDWNGYAPG--- 83

  Fly   229 ASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYT 293
               .|:||::||......:.||:..::.|...   :..:||..|.                    
  Rat    84 ---GAAAANAVAHGLNGGSPAAAMGYSSPAEY---HAHHHPHHHP-------------------- 122

  Fly   294 DTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVM----PG 354
                                    .|..||.|.                     |||::    ||
  Rat   123 ------------------------HHPAAAPSC---------------------ASGLLQTLNPG 142

  Fly   355 AGGAGGAGIAD--LPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRG--RQTYTRFQTLELEK 415
            ..|......|:  .|......|.:||..|.:..:     |.....|.:.  |..||..|.|||||
  Rat   143 PPGPAATAAAEQLSPSGQRRNLCEWMRKPAQPSL-----GSQVKTRTKDKYRVVYTDHQRLELEK 202

  Fly   416 EFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQ 480
            |||::.|:|.||:.|:|..|.|:|||:||||||||.|.:|       ||                
  Rat   203 EFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERK-------IN---------------- 244

  Fly   481 ETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHSIIAHNPGHLHHSVVGQNDLKLGL 545
                          :::.|||||||.......|..|||.........|.....|:.|        
  Rat   245 --------------KKKLQQQQQQQPPAPPPPQPSQPQSGALRSVPEPLSPVTSLQG-------- 287

  Fly   546 GMGVGVGVGGIGPGIGGGLGGNL 568
                  .|.|..||:.|..||.|
  Rat   288 ------SVPGSVPGVLGPAGGVL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 32/51 (63%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)
Cdx2NP_076453.1 Caudal_act 13..170 CDD:282574 41/221 (19%)
Homeobox 189..241 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.