DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: abd-A and unpg

Sequence 1:NP_732176.1 Gene:abd-A FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:593 Identity:121/594 (20%)
Similarity:184/594 (31%) Gaps:216/594 (36%)


  Fly    26 TTTPPN-------SSSAAVAAALAAAAASASASVSAS-------------SSSNNNSSNTIAGSN 70
            |.|||:       ...|.....|:|.|..||:::..:             :.::...::.|||  
  Fly    44 TATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAG-- 106

  Fly    71 TSNTNNSSSSPSSSSNNNSNLNLSGGSLSPSHLSQHLGQSPHSPVSSSS---------------- 119
                  ....|||.:.:.:       :..|...:|.....||.|..:..                
  Fly   107 ------GCYLPSSPAGHPA-------AQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFL 158

  Fly   120 PFQQHHPQVQQQHLNHQQQQHLHHQQQQH----HHQYSSLSAALQLQQQQHHISKLAAAAVASHG 180
            ||......|....|::::...|.:|...|    |.:...::||.::.:.|           |:.|
  Fly   159 PFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQ-----------ANPG 212

  Fly   181 HAHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAA 245
            .|..| ..|||.|.:|.|...|.||...|     |...::::...|..:.:..|...|       
  Fly   213 MAQLQ-EPTPPQAHSSPAKSGSHSPMEPA-----LDVGMDEDFECSGDSCSDISLTMS------- 264

  Fly   246 AAAAASSSFAIPTSKMYPYVSNHPSSHGG---LSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPA 307
                                   |.::.|   .|....:|..:.:.||                 
  Fly   265 -----------------------PRNYNGEMDKSRNGAYTNSDSEDCS----------------- 289

  Fly   308 SASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWM 372
                       ....|.|.......|  |.||.||.                             
  Fly   290 -----------DDEGAQSRHEGGGMG--GKDSQGNG----------------------------- 312

  Fly   373 TLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCL 437
                              :..|...||| |..:|..|.||||:|||...||:...|.:||.:|.|
  Fly   313 ------------------SSSNSKSRRR-RTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKL 358

  Fly   438 TERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQ----QQ 498
            :|.|:||||||||.|.|                     ::||..|.....:|......:    ..
  Fly   359 SEVQVKIWFQNRRAKWK---------------------RVKAGLTSHGLGRNGTTSGTKIVVPIP 402

  Fly   499 QQQQQQQQQQQHQQQQQ------QPQDHHSIIAHNPGHLHHSVVGQNDLKLGLGMGVGVGVGGIG 557
            ....:...:.||||.::      :|.....:.|...|.. ....|..:.....|..||:|| |:|
  Fly   403 VHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGF-EKFSGSTNASSPSGGPVGLGV-GVG 465

  Fly   558 PGIGGGLG 565
            .|:|.|||
  Fly   466 VGVGVGLG 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 28/52 (54%)
Abdominal-A 456..478 CDD:289192 0/22 (0%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.