DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP011134

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_309513.3 Gene:AgaP_AGAP011134 / 1270792 VectorBaseID:AGAP011134 Length:501 Species:Anopheles gambiae


Alignment Length:166 Identity:49/166 - (29%)
Similarity:68/166 - (40%) Gaps:42/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 DSL-GNAC------TQPASGVMPG--AGGAGGAGI---------ADLPRYPWMTLT--------- 375
            ||| |:|.      .|...||:.|  :||||.||:         :||......|.:         
Mosquito   152 DSLMGSASEDEDEEDQMRPGVLAGLVSGGAGAAGLHHGDGPLGASDLSVQSMSTDSKTGHDDSDQ 216

  Fly   376 -DWMGSPFERVVCGDFNGPNGCP------RRRGRQTYTRFQTLE-LEKEFHFNHYLTRRRRIEIA 432
             ...|.|..|   ||....|..|      :|||.:|..:.:.|| |:..|......||..|.::|
Mosquito   217 GSLDGDPDCR---GDSQAENKSPDDGAGSKRRGPRTTIKAKQLEVLKNAFSQTPKPTRHIREQLA 278

  Fly   433 HALCLTERQIKIWFQNRRMKLKKELRAVKEINEQAR 468
            ....|..|.|::||||:|.|    .|.:|::....|
Mosquito   279 KETGLPMRVIQVWFQNKRSK----ERRLKQLTSMGR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 18/52 (35%)
Abdominal-A 456..478 CDD:289192 3/13 (23%)
AgaP_AGAP011134XP_309513.3 LIM1_Lhx1_Lhx5 27..78 CDD:188753
LIM2_Lhx1_Lhx5 86..141 CDD:188761
Homeobox 247..300 CDD:278475 18/56 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.