DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubx and unpg

Sequence 1:NP_536752.1 Gene:Ubx FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:87 Identity:37/88 (42%)
Similarity:49/88 (56%) Gaps:11/88 (13%)


  Fly   266 GGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAH 330
            ||    ||.:.|:....|       :|...||.|..:|..|.||||:|||...||:...|.::|.
  Fly   301 GG----MGGKDSQGNGSS-------SNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIAT 354

  Fly   331 ALCLTERQIKIWFQNRRMKLKK 352
            :|.|:|.|:||||||||.|.|:
  Fly   355 SLKLSEVQVKIWFQNRRAKWKR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..351 CDD:278475 27/52 (52%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.