DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG11843

DIOPT Version :10

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_651663.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:205 Identity:41/205 - (20%)
Similarity:68/205 - (33%) Gaps:76/205 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 CGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIA---- 459
            |||.|::...|:|||||:                              |.:|.:|.::.:.    
  Fly    99 CGGVLISERFVLTAAHCL------------------------------ESERGEVNVVRLGELDF 133

  Fly   460 --------------------PGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESV 504
                                |||:  ...:|.|:.|:.|.|.........|.|:.|......:|.
  Fly   134 DSLDEDAAPRDYMVAGYIAHPGYE--DPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSF 196

  Fly   505 TDDVQGKFAGWN-----IENKHELQFVPAVSKSNSVCRRNL-RDIQA--------DKFCIFTQGK 555
            .      ..||.     ::...:|..|......|.||::.| |.::.        ::.|:.::..
  Fly   197 I------AVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMA 255

  Fly   556 SLACQGDSGG 565
            ...|.|||||
  Fly   256 QDTCNGDSGG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Tryp_SPc 371..616 CDD:214473 41/205 (20%)
CG11843NP_651663.1 Tryp_SPc 68..312 CDD:238113 41/205 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.