DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment modSP and CG43125

DIOPT Version :10

Sequence 1:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:154 Identity:35/154 - (22%)
Similarity:54/154 - (35%) Gaps:55/154 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 EQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDE 419
            ||:||:.:.    ||.         .||.|.:   ..|...:..|.|:|:....|:|||.|: |.
  Fly    24 EQNCGKSSV----FSP---------APWLVKI---RPELSSNITCTGTLINERFVLTAASCI-DY 71

  Fly   420 GTRL---------------PYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENY 469
            .|.|               ...|:...|..|..:|:|.                       :|::
  Fly    72 QTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYS-----------------------SESH 113

  Fly   470 YQDLALLTLDEPFELSHVIRPICV 493
            ..::|||.|.........|:|||:
  Fly   114 QYNIALLRLKTSVVYKKNIQPICI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Tryp_SPc 371..616 CDD:214473 29/138 (21%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:473915 28/126 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.