DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10340 and AT2G34050

DIOPT Version :8

Sequence 1:NP_650565.2 Gene:CG10340 / 42020 FlyBaseID:FBgn0022344 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_565778.1 Gene:AT2G34050 / 817966 AraportID:AT2G34050 Length:248 Species:Arabidopsis thaliana

Alignment Length:253 Identity:70/253 - (27%)
Similarity:112/253 - (44%) Gaps:18/253 - (7%)


  Fly    29 RRAEEAIEKLKEDNPYYSKYASK------IAKLQQTSAEEFLDRVERVVNPIKDGQSQARSYSEL 87
            ||...:|..|.:|....|.|:|.      .:...|..|...|.......|.||        ::.|
plant     2 RRIVGSISSLAKDKLSSSSYSSSRQIFTARSSSWQRDASSKLSEASLPGNHIK--------WASL 58

  Fly    88 LNPKQKLQAEQAAELPHKKLTDIMKLELIEDKTAEEVSQIWLEYHKTKEVLAATLSTSQYENLMA 152
            .:.:....|.....|..|.|..||.|...:.|:.||::.||.:||..:..:..|:....|..|..
plant    59 GSVRNSRFASGFTPLQQKPLDSIMDLARAKTKSPEELTSIWDDYHLGRGHIGLTMKAQLYRLLEQ 123

  Fly   153 RAKEHPVFLLPLPRSEGFEFVMLQFAANTVHFTPLLAYQVHHENAPECLTVVHYTEVQD-KGVVL 216
            ||.|...|::||.|..|:..:..|..|..:.||.|..|:.....|...||...|||:.: |.:|.
plant   124 RASECRYFVIPLWRGNGYITMFAQVEAPHMIFTGLEDYKARGTQAAPYLTTTFYTELSETKDLVF 188

  Fly   217 MRGE-YDTKVLTAQEAQCLANELQMFYLKPDEGKLRLLNTFTRKPDEFKHMDLIKEVE 273
            :||: ..|..||.:||:.:....|.|||  ::.:.:||..|.:...:|:..|:::.::
plant   189 IRGDVVFTSKLTDEEAKWIMETAQSFYL--NDSRYKLLERFNKHTHDFEFKDVLQALD 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10340NP_650565.2 ATP11 29..271 CDD:284139 70/249 (28%)
AT2G34050NP_565778.1 ATP11 <76..241 CDD:284139 53/166 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I2290
OMA 1 1.010
OrthoDB 1 1.010 D1108259at2759
OrthoInspector 1 1.000 T193082
orthoMCL 1 0.900 OOG5_128892
Panther 1 1.100 LDO PTHR13126
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.