DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scp2 and Rcn3

DIOPT Version :8

Sequence 1:NP_524381.1 Gene:Scp2 / 42015 FlyBaseID:FBgn0020907 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001008694.1 Gene:Rcn3 / 494125 RGDID:1359365 Length:328 Species:Rattus norvegicus

Alignment Length:114 Identity:22/115 (19%)
Similarity:47/115 (41%) Gaps:22/115 (19%)


  Fly    71 DKDNDGQVSVDEWCNMWDAYAKDPSSVMD-WQNAYMNFMFDLEDASHDGGIDVTEF--------- 125
            ||:.||.|.|:|:  :.|.|:.:|..... |.........|..|.:.||.:|.:|.         
  Rat   213 DKNKDGYVQVEEY--IADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGRLDGSEVGYWVLPPSQ 275

  Fly   126 --TLVCSSYGLEKTECEEAFAKMSQGQSEVTREQFAALWKEYFAAEDVN 172
              .||.:::.|.:::.::        ...:::.:..:.|..:..::..|
  Rat   276 DQPLVEANHLLHESDTDK--------DGRLSKAEILSNWNMFVGSQATN 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Scp2NP_524381.1 EFh 10..87 CDD:298682 7/16 (44%)
EF-hand_7 14..86 CDD:290234 7/15 (47%)
FRQ1 71..163 CDD:227455 21/104 (20%)
Rcn3NP_001008694.1 EFh_CREC_RCN3 44..311 CDD:320028 21/108 (19%)
EF-hand motif 44..73 CDD:320028
EF-hand motif 79..110 CDD:320028
EF-hand motif 117..146 CDD:320028
EF-hand motif 167..196 CDD:320028
EF-hand motif 204..233 CDD:320028 9/22 (41%)
EF-hand motif 245..274 CDD:320028 6/29 (21%)
EF-hand motif 281..311 CDD:320028 2/38 (5%)
Prevents secretion from ER. {ECO:0000255|PROSITE-ProRule:PRU10138} 325..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10827
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.