DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Decay and Strica

Sequence 1:NP_477462.1 Gene:Decay FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster

Alignment Length:244 Identity:71/245 (29%)
Similarity:113/245 (46%) Gaps:42/245 (17%)


  Fly    60 ILNHKDVKGQKQ-RVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQNDCFV 123
            |.||:....:.: |.|:.:|...:.||.:.....|....|.|...|..|::.:..:|.......|
  Fly   317 IFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALV 381

  Fly   124 LAVMSHGT-EGKVYAKDMSYPV-ERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFA 186
            |.::|||| ..::.|||..|.: :.:..|.|.:  :|||:||||.|:|||:|     ..:...| 
  Fly   382 LVILSHGTRHDQIAAKDDDYSLDDDVVFPILRN--RTLKDKPKLIFVQACKG-----DCQLGGF- 438

  Fly   187 VMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEA 251
             ||        .|.||    ..|..:||..|||::.|.||| .:||:.|||:||..|     |.:
  Fly   439 -MT--------DAAQP----NGSPNEILKCYSTYEGFVSFR-TEDGTPFIQTLCEAL-----NRS 484

  Fly   252 ATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTKTF 300
            .....::.:.:    |.:...:.||..        :::|:..||||..:
  Fly   485 GKTSDIDTIMM----NVRQVVKMQSKD--------RQIPSVTSTLTSKY 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 71/245 (29%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10454
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.