DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gyc89Db and Gucy1b2

Sequence 1:NP_650551.1 Gene:Gyc89Db FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_766398.1 Gene:Gucy1b2 MGIID:2660873 Length:824 Species:Mus musculus

Alignment Length:731 Identity:193/732 (26%)
Similarity:330/732 (45%) Gaps:156/732 (21%)


  Fly     1 MYGMLYESVQHYIQQEYGMETWRKV---CQIVDCKHQSFKTHQIYPD----KLMPDFAAALSAST 58
            |||.:...:|..:.:::|.|||.|:   .::.|.    |.|:.:|.|    ||:.:...||..  
Mouse    82 MYGFINTCLQSLVTEKFGEETWEKLKASAEVQDV----FMTYTVYDDTITVKLIQEACKALDV-- 140

  Fly    59 GESFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQLTN 123
              |.:..:..||..|.:|....|||:|:|:.|....:|::::|.:|..:..:|.:|.:||.::..
Mouse   141 --SMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEG 203

  Fly   124 MDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIKLTEGPLTV 188
            ..|....:.|.|.|.|:...:.|.:..|||:|:..|:...:|:...::  ...|  |.......|
Mouse   204 GADGAMRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSILDMNEEV--ERTG--KKEHVVFLV 264

  Fly   189 IVKYRLDF---------DNRDYMAK-------------------------------RVNVI---- 209
            :.|.|...         |:.:..||                               |.:|:    
Mouse   265 VQKARRQIRGAKVNRPRDSENIQAKQESLQGTLLRKKERYLSIPVCPGEKSHSAVVRASVLLGKG 329

  Fly   210 --------AHPSQLKMPSVDLNVFLELFPFTIVLDHDMKITLAGEKIVETWILHNPGVNPKTFIG 266
                    ..|.:|   .::..||...|||.:|.|..:::..||..|.:    :.||:..:.|  
Mouse   330 PLGDTFQPVFPERL---WIEEEVFCNAFPFHVVFDEALRVKQAGVNIQK----YVPGILTQKF-- 385

  Fly   267 SHILERFKCRRPKDTQIQWETILQMRTVLFEFELIRTGHNRAAYDAALNFDFENFDEASSLNEAQ 331
             .:.|.|....|:.|                       .|.::....:|..|             
Mouse   386 -GLDEYFSIVHPQVT-----------------------FNISSICKFINSQF------------- 413

  Fly   332 AMALASAKEFSAENAKEEAAAAATSKDEIDPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCS 396
              .|.:.:|...|..|.:.                        ::.|:|||.:::.:..::|:||
Mouse   414 --ILKTRREMMPEAWKSQP------------------------TLKLRGQMIWMESLKCMVFMCS 452

  Fly   397 PLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKR 461
            |.:.:|.||....::|:|:.||..:|:|::...|..:::|:..:.|:::.:....|..||.. |:
Mouse   453 PKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIE-KK 516

  Fly   462 QGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSVIFIEVMNIYDSGSNNIQDA---MQAVTTLNK 523
            :.:.|||:|:|..:|.::::.::.....||..:::|.:|:..     .||..|   :|.|..||.
Mouse   517 KTETLLYAMLPEHVANQLKEGKKVAAGEFETCTILFSDVVTF-----TNICAACEPIQIVNMLNS 576

  Fly   524 VFSALDEEIISPFVYKVETVGMVYMAVSGAPDVNPLHAEHACDLAL--RVMKKVKAHALPG--VA 584
            ::|..|.......||||||:|..||.|.|.|.....||:...:.||  |:..|...:.:.|  :.
Mouse   577 MYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVTGEPIQ 641

  Fly   585 IRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARG 649
            |||||::|||:|||||.|:||||||||||||||||||...|..:.||......::..|:::..||
Mouse   642 IRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRALENKGFEIVTRG 706

  Fly   650 FVKVKGKGEMETYWLL 665
            .::|||||:|.||:|:
Mouse   707 EIEVKGKGKMTTYFLI 722

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:285002 46/166 (28%)
HNOBA 218..479 CDD:285003 54/261 (21%)
CYCc 460..646 CDD:214485 75/193 (39%)
Guanylate_cyc 488..665 CDD:278633 79/184 (43%)
Gucy1b2NP_766398.1 HNOB 83..244 CDD:285002 46/169 (27%)
HNOBA 348..534 CDD:285003 54/256 (21%)
CYCc 513..703 CDD:214485 75/196 (38%)
Guanylate_cyc 540..722 CDD:278633 79/187 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5138
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D245586at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.820

Return to query results.
Submit another query.