DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gyc89Db and gcy-31

Sequence 1:NP_650551.1 Gene:Gyc89Db FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001024889.1 Gene:gcy-31 WormBaseID:WBGene00001551 Length:702 Species:Caenorhabditis elegans

Alignment Length:703 Identity:194/704 (28%)
Similarity:345/704 (49%) Gaps:121/704 (17%)


  Fly     1 MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGESFDFC 65
            |||::.:.:..||:::||..||.:|..:......:|:..:.:.:.|......|....||:..|..
 Worm     1 MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGDPVDEL 65

  Fly    66 MNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQLTNMDDDGAV 130
            |...|..|.:|.:.|.::|::|..||.|..||..:||:|..:|||:||:|.||....:....|..
 Worm    66 MTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFYCEHESRTGLT 130

  Fly   131 ILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIKLTEGPLTVIVKYRLD 195
            :.|||.|.|...|:.||:..:::|.:..::...:|:.::|        :.|..      |..||.
 Worm   131 LHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHD--------LNLEH------VIMRLH 181

  Fly   196 FDNRDYMAKRV---NVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMKIT------------LAG 245
            |:|.|:..:..   |:  :.|.|:...:..::|.::|||.||.:..|:|.            :.|
 Worm   182 FNNLDFNRQGTAYRNL--NDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMAGIVG 244

  Fly   246 EKIVETWILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFELIRTGHNRAAY 310
            :||.:|::|..|      ||      ||:          ||.|:.....:||.            
 Worm   245 KKINQTFLLMRP------FI------RFR----------WEEIMLHSNNIFEL------------ 275

  Fly   311 DAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSK-DEIDPATGQRRHSVG-- 372
                                          .|::..:|:.......| .::|..| :.||.:|  
 Worm   276 ------------------------------ISSDPIQEDEDGILVYKTTDVDQMT-EERHRMGDG 309

  Fly   373 --LRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKL 435
              .:.:.|||||||:::.:|:.|:..|::.:|.:::..||::||...|..||:||:|..|..::|
 Worm   310 EREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDSSRDLVLASTQQSAEL 374

  Fly   436 EIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHV--CQSFEEVSVIFI 498
            :::..:|.|:|..:.:::......:|:.|:|||.|:|:.:|.::|..|..|  |:.|:.|:::|.
 Worm   375 KLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLRHGESAVACCERFDSVTILFT 439

  Fly   499 EVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVNPLHAEH 563
            :::......|:  ...::.:..|..:::..|:.|.:..||||||:|..||.|||||......||.
 Worm   440 DIVEFTKMCSS--LTPLEVIEFLKVIYTNFDKIIDTHGVYKVETIGDAYMVVSGAPTKTEHDAEF 502

  Fly   564 ACDLALRVMKKV--------KAHALPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRME 620
            ..|.|.:.:.:.        |.|.   :.||.|::||.|||||||:.:|||||||:||..|::||
 Worm   503 ILDCASQFLVEAGKMVNMNNKIHK---IDIRAGVHSGSVVAGVVGLSMPRYCLFGETVYVANKME 564

  Fly   621 SSSDPWMIQLSNYTALKVQKVG---YKVEARGFVKVKGKGEMETYWLL--EGP 668
            .:|.|..|.:|..|..|:::..   |:.|.|..:::|....::|::::  .||
 Worm   565 QNSSPMKILVSETTHNKIEESDPGLYQFERREEIEIKDDQTIQTFFVVSRHGP 617

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:285002 48/159 (30%)
HNOBA 218..479 CDD:285003 65/278 (23%)
CYCc 460..646 CDD:214485 70/199 (35%)
Guanylate_cyc 488..665 CDD:278633 62/188 (33%)
gcy-31NP_001024889.1 HNOB 2..164 CDD:285002 48/162 (30%)
HNOBA 221..418 CDD:285003 60/262 (23%)
CYCc 397..592 CDD:214485 70/200 (35%)
Guanylate_cyc 429..613 CDD:278633 62/189 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D245586at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45655
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.