DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG18735

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:248 Identity:82/248 - (33%)
Similarity:122/248 - (49%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDG------------HEQQPRE 88
            |||.|:|....::|:.:.|.......||||:::..:|:|||||::|            |.:|...
  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146

  Fly    89 FTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLG-KVAPIRLPTVGE 152
            ..:....:.|           :..||.|...:.:.|:||:|..:   .:.|| .:.|:.:||..|
  Fly   147 VKIVDRRVSR-----------VLIHPKYSTRNFDSDIALIRFNE---PVRLGIDMHPVCMPTPSE 197

  Fly   153 AISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA---ARNT 214
            ..: ...|||:|||.:|...|: |..|:...|..::||:|.|.......:|:.|.||.   ....
  Fly   198 NYA-GQTAVVTGWGALSEGGPI-SDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGK 260

  Fly   215 DACQGDSGGPISAQGT-----LIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
            |:||||||||:...|:     |.||||||.|||.|..||||||:.  :...||
  Fly   261 DSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVG--SFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 80/246 (33%)
Tryp_SPc 37..263 CDD:238113 81/247 (33%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 80/246 (33%)
Tryp_SPc 83..314 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.