DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and prss56

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_017207703.2 Gene:prss56 / 563528 ZFINID:ZDB-GENE-070912-579 Length:849 Species:Danio rerio


Alignment Length:257 Identity:82/257 - (31%)
Similarity:126/257 - (49%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQP------REFT 90
            ||.:||:.|..|..|.:|:.::||.....:||..::.|:|.:|||||..|...:.      .||.
Zfish   186 QPRARIIGGSPAPLGSWPWLVNLRLDGALMCGGVLVDSSWVLTAAHCFAGSRSESYWTAVVGEFD 250

  Fly    91 LRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPL---GKVAPIRLPTVGE 152
            |.:    ..:...:..|..|..||.::....|.|:||:.     ||.|:   .:|.|:.||:..:
Zfish   251 LTK----TDADEQIMKVNRIITHPKFNPKTFNNDIALVE-----LSSPVILSERVTPVCLPSDLD 306

  Fly   153 AISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGG---VTEAMFCAA--AR 212
            . ....|.:|:|||.:....|....|:::...| ::|..|.:.|    |   :|..||||.  :.
Zfish   307 P-PAGTPCLVAGWGSLYEDGPSADVVMEAKVPL-LSQATCQSAL----GKELLTNTMFCAGYLSG 365

  Fly   213 NTDACQGDSGGP------ISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIRLLTKL 268
            ..|:||||||||      :|.:..|:||.|||.||.:...||||||:.  ....|:  ||::
Zfish   366 GIDSCQGDSGGPLIFQDRLSGRFQLLGITSWGDGCGEKGKPGVYTRVT--AFSDWV--LTEI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 77/245 (31%)
Tryp_SPc 37..263 CDD:238113 77/245 (31%)
prss56XP_017207703.2 Tryp_SPc 191..419 CDD:238113 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.